KEGG   Crassostrea gigas (Pacific oyster): 105340795Help
Entry
105340795         CDS       T03920                                 

Definition
(RefSeq) histone-lysine N-methyltransferase NSD2
  KO
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:crg00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105340795
Enzymes [BR:crg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105340795
Chromosome [BR:crg03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105340795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1310 aa AA seqDB search
MENTKAAVNGGCTSPSFRHHLPQVANLTRNSKIAQSKAGAKVEPVKDEATLVVEDTGKVV
KIEIMENASGEQERPLVHPKERAKAEARSQIKIEKEQTAKQESDSNPDQSVQQDPQTNTG
DKSEASGESEAKSSSTLTKKAETKQSTPVRTKQVKEKSGNYKNIFEVTSVEGKRQRKPKV
VIDMEELSKGDKSSSRNTSLSGGDLDVSLEPEVNKSTTFTSPVVEKPAEWKMGDQLWAKV
AGHPWWPCMVAKDPYEDLYTKMKARSRLYHVTFFGNEGERGWAGSNSIMEFKGKDKYDEH
VKQAFLNAKKGEKLKLEKLYREYPNRQAAWLIAIHQAEEAMTMSVEERVEKFKCVCTPEK
KKKKSTDSGNDNKQVKSPKGKSKERIQKRKRQSSEQVKSSPAPSPAAKPSSKRRRLDEGS
SHKDKKSEGSFEVFCSKHRDSMMADHPEFDEATLNECLQQQWLMMSQKQKSRYKSKLQDT
PKEPVISKVAERKMSPTEEEDEDSEKETKIVAKLKLKREKSTSDESSSDNQEEEKNSLCK
SPRYLCQVCEDNGDLMECEGECHNYFHKSCVSENVEEPFKCEECKSGVHTCFACKEKDEN
TKKCSVHLCGKFYHENCLNKLMHSKSDSNKGFVCPLHQCATCAIESSKKTKASKGRLLRC
VRCPTAYHTGDFCIAAGSENLPGHNIVCSKHFQPNRTQKYHTHINVSWCFVCNLGGSLIC
CDSCPASFHAECLNINPPEGNWYCNDCAMGKQPLYGDIVWVKLGSYRWWPSEICHPKRVP
HNIQEKTHQVGEFPVHFFGTNDYFWIHKGRAFGFQDGDKYSKETSKNKHLAKIFARGVQE
ATEAFQALKALRADKEKMFIERSEKKPAPFKFVKNNIPVGSVVIPKPDLTSIPRCECDPN
SEAPCSSDTDCLNRMLMYECHPSVCQCGEKCHNQRFQRREYPDCTPFKTEGRGWGLRTNV
DIKKGQFVHEYVGELIDEEEVKRRIDESHENNISNYYMLTLDKNRVIDAGPKGNLSRFMN
HSCAPNCETQKWTANGDVRVGLFAIYDIPAGTELTFNYNLECLGNDKTKCNCGAELCSGF
LGVRPKSAVAASVAKGKKKDEKKKRKRNKKKIDGKKEHDDECFRCGEGGELVMCDRGGCP
KVYHLHCLKLSKPPHGKWDCPWHHCDECGKPAITMCTECPNSFCATHTEGHIKEVDGVAV
CSEHDEVSSSGASSDAQSDDGGEDSNGQARTKAILKENLIRKRNLNTKQEEEAGAGGSKK
PRKQSVGESKKGEGKRGKSAGGNLLAVVPMFDDSDEGSDDLVIDIPAVPL
NT seq 3933 nt NT seq  +upstreamnt  +downstreamnt
atggagaacacgaaggcagcagtcaatggggggtgtacctccccctccttcaggcatcac
ctcccccaggtggccaatctaacccggaacagcaagatagcccagagtaaggccggcgcc
aaggtggagcccgtcaaagacgaagccactctggtggtggaggacacagggaaagtggtc
aagatcgagatcatggaaaacgcatcaggtgaacaagaaagacctcttgtacacccaaaa
gaacgagctaaagctgaggcaagatcccagatcaagatcgaaaaggaacagacagcaaag
caggagtcggatagtaatccagaccagtctgtgcaacaggacccgcagacaaacactggt
gacaagtcagaggcttcaggggaaagtgaggccaaaagctcaagtacattaacaaagaaa
gcagaaactaaacagagtacgccagtgagaacaaaacaagtgaaagagaaatcaggaaat
tataaaaacatattcgaagtgacaagtgtggaagggaagagacaaaggaagcccaaagtt
gtgattgacatggaggaactgtcaaaaggagataaatcgtccagcaggaacactagtctc
agtggtggtgatttggacgtttcgctggagccagaagtgaacaaatcgacgacatttaca
tctcccgtggtggagaaaccggcagagtggaagatgggtgaccagttgtgggcgaaggtg
gctggacatccctggtggccgtgtatggtggccaaggatccttacgaagatctttacacc
aaaatgaaagcaagaagcagactctaccacgtcacattttttggaaacgaaggagaacgg
ggatgggcggggtcgaactcaataatggaattcaaaggaaaggacaaatatgatgagcat
gtgaaacaggcatttctcaatgctaaaaagggtgaaaaattaaaacttgaaaaactctat
agagagtatccaaatcgccaggcagcttggctaattgccatccatcaagcggaggaagca
atgacaatgtctgtggaggaacgtgtggaaaaattcaaatgtgtgtgcacgcccgaaaag
aaaaagaaaaaaagcacagacagtggtaacgataataaacaagtcaagtccccgaaaggt
aaatccaaggagagaattcagaaacggaagcgacagtcatcagaacaagtgaagtcctct
ccagctccgagccctgcagcaaaacctagctccaagcgacgaagactggatgaaggttcc
tcccataaagacaagaaatcggaaggttcttttgaagtgttctgcagcaaacacagggac
agcatgatggcagaccatcctgaatttgatgaagctacgctcaacgagtgcctgcagcag
caatggctgatgatgagccagaaacaaaagtcccgatacaaatccaagctccaagacacc
ccaaaagagcctgttatatccaaggtagcagagaggaaaatgtccccaacagaggaggaa
gatgaagattcggaaaaggaaacaaaaatagttgcaaaattaaagttgaagagagaaaaa
tccacaagtgatgaaagttcatcagataatcaggaggaagaaaagaactctttgtgtaaa
agtccgaggtacctgtgccaggtgtgtgaagataatggcgacctgatggagtgtgagggt
gaatgccataattatttccacaagtcttgtgtcagtgagaatgtggaggagccgttcaaa
tgcgaggaatgtaaatcaggggttcacacatgctttgcatgcaaggagaaggatgagaac
accaagaagtgttctgttcatttatgtgggaagttttaccacgagaactgcctcaataaa
ctgatgcactccaagtctgacagcaacaagggcttcgtgtgccccctccatcagtgtgct
acatgcgccatcgagagctccaagaaaaccaaggctagcaaaggtcgacttctccggtgt
gtgcgatgtccgacagcctatcacactggagatttctgtatcgccgccgggagtgaaaat
ctcccgggacacaacattgtctgcagtaaacatttccagcccaaccgcactcagaaatac
cacacccacattaacgtcagctggtgcttcgtgtgtaacctaggcggatctctgatttgc
tgtgacagctgtcctgcctccttccatgcagagtgtttgaacatcaaccccccagaaggc
aattggtactgtaatgactgtgccatgggtaaacagcctctctatggagacattgtctgg
gtaaaactgggcagttatagatggtggccctctgaaatctgccatccaaagcgtgtacct
cacaacatccaggagaagactcaccaagtgggagaattcccagtgcatttctttggaact
aatgactatttttggatccataaaggaagagcatttggatttcaagatggtgacaaatat
agcaaagaaacttcaaagaataaacatctagctaagatatttgcaagaggagtgcaagag
gcaactgaagcatttcaggccctgaaagccttacgagctgacaaagaaaaaatgtttatt
gagaggagtgagaaaaagccagctccttttaagtttgtaaagaataacattccagtcgga
agtgtggtaattcccaaaccagacttgaccagcattcctcggtgcgaatgtgacccaaat
tcggaagctccgtgcagcagtgacacggactgcctgaaccgcatgctgatgtacgagtgt
cacccgagcgtttgtcagtgtggagagaaatgtcacaaccagcgattccagaggcgtgaa
tacccagattgtactccgttcaaaacggagggcagaggctggggattgagaaccaatgtg
gacattaaaaagggacagtttgtgcacgagtatgtaggagagcttattgatgaagaggaa
gtcaaaaggaggatagacgaatcccatgaaaataacatcagcaactattatatgctcaca
ctggataaaaacagagtaattgatgcgggaccgaagggtaatctgtccagattcatgaac
cacagctgtgctcccaactgtgaaactcaaaagtggaccgccaatggggacgtcagagtc
ggattatttgcaatttatgatattcctgcaggtactgagttgacatttaactacaacctg
gagtgcctaggaaacgataaaaccaagtgcaactgtggagctgaattatgcagtggcttc
ttgggtgtacgacccaagtctgctgtggctgcttcagtggctaaaggcaagaaaaaggat
gagaagaagaagaggaagaggaataagaagaagattgacgggaagaaggagcacgatgat
gagtgtttccgctgtggtgagggcggggagctggtgatgtgtgaccgcggaggctgtccc
aaggtctaccacctccactgtctgaagctgtccaaacctccacatggtaaatgggactgc
ccttggcatcattgcgatgagtgcggaaaaccggccataaccatgtgtacggagtgtccc
aactcgttttgtgccacccacacagagggccacatcaaggaggtggatggggtggcggtc
tgtagtgaacatgatgaggtcagctcgagtggtgcatcctctgacgctcagtctgatgac
ggtggggaggacagtaacggacaggcccgcaccaaggccatcctcaaggaaaacctgatc
aggaagcgcaacctcaacaccaaacaggaagaggaggcaggcgccggtggaagcaagaag
cctcgcaaacagagtgtcggagaatccaagaaaggggagggtaaaagagggaagtcggcc
ggggggaacctcctggctgtggttccaatgtttgatgacagtgacgaggggtcggacgat
ctggtcatagatattccagctgtcccgttgtaa

DBGET integrated database retrieval system