KEGG   Crassostrea gigas (Pacific oyster): 105341160Help
Entry
105341160         CDS       T03920                                 

Definition
(RefSeq) glycogen [starch] synthase-like
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    105341160
Enzymes [BR:crg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     105341160
Glycosyltransferases [BR:crg01003]
 Polysaccharide
  Storage polysaccharide
   105341160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 695 aa AA seqDB search
MRRRNSFYRSFKDACPEFEEMLMDRGATAAAQNKWVFEIAWEVANKVGGIYTVIKSKAPV
SVAELGEQYCLLGPYNEACVRTEVEILEPSHYVYRQTLQTMRDAGIKVHFGRWLIDGYPK
VILFDIGSAAWKLDEFKHELWEKASIGIPWHDRESNDAVIFGALVAWFIGEFRKNLTDQP
IVVTHFHEWLAGAGLMDLRTRKVDCITIFTTHATLLGRYLCAGSSDFYNNIDKYNLVKEA
GDRQIYHCYCMERTAVHSSQVFISVSEITEVEAEHLLKRKPNMIVPPNGLNVVKFSTIHE
FQNMHAICKEKIHDIVRGHFYGHYDFDLDKTLYFFTAGRYEFSNKGADMFIESLARLNFY
LKQANSEATVVAFLIFPTKTNNFNVESLRGQAISKQLKETVHHVQTQIGKRIFEQSLKGK
ILTGDEILEQEDIVKLKRCIYSAQRNSLPPICTHNVNEDANDQILNALRRCQLFNRKEDR
VKVVFHPEFLNSTNPLFGLDYEDFVRGCHLGVFASYYEPWGYSPAECTVYGIPSISTNLS
GFGCFMQEHINDPKSYGLYIVDRRYKSPDESIHQLTQYMYDFTCLSRRQRIIQRNRTERL
SDLLDWRNLGVYYRKARQIAVARGYPDLAAKEEEILQEKRFMYPRPASEPSSPSASRSST
PAPSEHGDDEDDDIDEDEENAEMSSNPESDMPMFK
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgagaagacgaaacagtttttacagaagttttaaagatgcatgtccggaatttgaagag
atgcttatggacagaggggccactgcagctgcacaaaacaaatgggtgtttgaaatcgcc
tgggaagtagcaaataaagttggtggtatctacactgtcatcaagtccaaggccccggtc
agtgtagctgagttaggagaacagtactgtctgctgggtccctataacgaggcatgtgtc
agaacggaggtggagatcctggagccctcccactatgtctacagacagacgctacagacc
atgagggacgcaggtatcaaggttcattttggtcgctggctgatagacggatatcctaaa
gtcattttgtttgacatcggatctgctgcttggaagctggatgaattcaaacatgagctg
tgggagaaagccagcataggaatcccctggcacgaccgcgagtcgaacgacgccgtcata
ttcggggctctagtagcctggtttattggtgagtttcggaagaatctgactgatcagccg
attgtagtgacccactttcacgagtggttggctggggcggggctgatggacctgcggacc
aggaaggtcgactgcatcaccatcttcacgactcacgccacactgctggggagatacctg
tgtgctggcagctcagacttctacaacaatatagacaagtataacttagtcaaggaggcc
ggtgaccgtcagatataccactgttactgcatggagaggaccgctgtccactcttctcag
gtgtttatcagtgtgtccgagatcactgaggtggaggcagagcacctgctcaaacggaag
cccaacatgatcgtcccacctaacggattaaatgtggtcaaatttagtaccatccatgag
ttccagaatatgcatgccatctgcaaggagaagatccacgacatcgtcaggggacatttt
tatgggcactatgactttgatctggataagacactatactttttcacggctgggagatat
gagttttccaacaaaggagcggacatgttcatagaatcactggcaagactaaacttttat
ctcaagcaagctaacagtgaggcgacagtggtggctttcctgatcttccccaccaagacc
aacaacttcaacgtggagtccctgcggggccaggccatctccaaacagctgaaggagacc
gtgcaccacgtacagacacagatcggcaagaggatctttgaacagagcctgaagggcaaa
attctaactggagatgaaattctggaacaagaagatatagtgaaacttaagaggtgtatc
tactctgctcagagaaacagcttacctcctatatgtacgcacaatgttaatgaagacgcg
aacgaccaaatccttaatgcccttcgacgatgtcaacttttcaacagaaaagaggacaga
gtgaaggttgtatttcaccccgagttcctgaactccaccaaccctttgtttggccttgac
tacgaggactttgtccggggctgtcaccttggggtgttcgcttcgtactacgagccctgg
ggctattcaccagctgagtgcaccgtgtacgggatcccaagtatttccacgaacctctca
ggcttcggctgtttcatgcaggaacacatcaatgatcccaagtcctatggactctatatt
gtagaccgccgatataagagtccagacgaatcaatccatcagctgactcagtatatgtat
gatttcacctgtttatcccggcgacagcgtatcattcagagaaatcgtacggagcgcctc
agtgacctcctagactggaggaacctgggagtgtactacagaaaagcccgccagattgct
gtagcccggggataccctgaccttgctgccaaggaggaggagatcctacaggaaaagagg
ttcatgtaccctcggccggcctccgaaccttcctcaccctcggcctcgcgcagctccacc
ccagccccctcggaacatggggacgatgaagatgacgatatcgacgaggatgaagagaat
gcggaaatgagttctaacccagagtccgacatgccgatgtttaagtga

DBGET integrated database retrieval system