KEGG   Crassostrea gigas (Pacific oyster): 105346468Help
Entry
105346468         CDS       T03920                                 

Definition
(RefSeq) histone deacetylase 6 isoform X1
  KO
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
Enzymes [BR:crg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     105346468
Protein phosphatases and associated proteins [BR:crg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105346468
Messenger RNA biogenesis [BR:crg03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     105346468
Membrane trafficking [BR:crg04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    105346468
Chromosome [BR:crg03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     105346468
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1161 aa AA seqDB search
MHQDYSEEDFDPDDQLRGKDVGFRSPTQDVNPSSPEAKDKKMSLEELKRMGRAERQRMRE
ERRRQKSDSDSESEYLVGKLAEIALTVREPDPVEGTGLIYDERMLKHKNLWDDHHPENPA
RISGPFKRCCELGLIDRCVRLEAQYSTEDMILLQHSQMLIETLKHTTEMNLEELRAEAIK
YDSIYLNNSSYECALLSLGSTVELMEQILKRKVRNGMAIIRPPGHHAMTEEFNGFCFFNN
VAIAAKHALENLKLKKILIIDWDVHHGQGTQQMFYNDPRVLYFSIHRYEFGKFWPNLRES
DYDFIGEGKGVGYNINVPLNQIGMADHDYLAIFHQILMPIASEFDPELVLISAGYDCAIG
CPEFEPELVIVSAGYDSAIGDPKGQMGVTPAAFAHLTHKVMSLAQGRVAVILEGGYCLKS
LTESAAMTLRTLLGDPCPRIPPSQEPCDSVTESILSVIKVLRPHWKCLQYQGFTSDPCPY
EEVNQLPPKPDVQFMDVENKPKEYPECLEPYPVEEYYEEDRKCSPIIDRLIAKTNLDKAK
HRTCIAYDEGMRAHYTSSSYYHPEAPDRITRIFDKHTEWGLTQRCTRVETRMATEAELAL
IHSTTYLNEIKSLEDKNPFELKKLERKFQSIYLCRDSYFCARMAAGFVLDVVDNVMTEQS
QNGVAIVRPPGHHAECTEAMGFCFFNNIAIAAKYAQNKYNVKKVLIVDWDIHHGNGTQRQ
FYDDPSVLFISLHRYDRGFFYPSSPQGCQTMVGKGEGTGFNVNIAWNNGPMGDSEYIAAF
QQIVMPIAYEFGPELVLVSAGFDAALGDPLGNYLVTPLGYGHMTHMLSSLANGRVILALE
GGYHMAAIANSMAMCTSILLGDACPHLPYTEPKDSAVQCIRDVLDVQRNHWKSLKFRVNI
KTEEDNEEDHFKAKESQRTMEDEEDEEKMNELAKKLTDIQVTEDSSNPREDVVVQNSDGS
SEKSSKEIMDEMKEPMEASTKGADNPVTKGEGGKKHTVEGEDPGSLCAKGGEVRGAEGGR
QPSDATPLSANDVLKQLETQGHTQMFAVTPLPWCPHLDTVTPVPRGRIDTGAPCEECGDV
TENWICLVCYKVFCSRFVNEHMLMHGVMEEHLMCLSFSDLSVWCYGCDHYIDNVALFHAK
NAAHCDKFGSSLPTPPSLSQT
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaggactattctgaagaggattttgaccctgatgatcagctcagaggaaaagac
gtaggattcagaagtcctacccaagatgtgaacccttcaagcccagaagccaaagacaaa
aaaatgtcccttgaagagctaaagagaatgggacgggcagaaagacagagaatgagagaa
gaaaggaggagacaaaaatcggatagtgactcggagtccgagtacttggtcgggaaactt
gcggaaatcgccttgacagtaagagaaccggaccctgttgaggggactggcttgatatat
gatgagcggatgttgaaacacaaaaacctgtgggatgaccatcacccagaaaacccagcc
agaatcagtggcccattcaagcggtgctgtgagctcggcctcatcgacagatgtgttcgg
ctggaggcacagtattctacagaagacatgatattactgcagcattcacaaatgttgatt
gagacattgaaacatacaacagagatgaacttagaggagctgagagctgaggccattaaa
tacgactcgatctacctcaataatagtagctatgagtgcgccctgttgtccctggggagt
acagtggaattaatggaacagattctcaaacggaaggtgcggaatggtatggctattatc
agaccgcctgggcatcatgcaatgactgaggaattcaatggcttctgtttcttcaataat
gttgccattgctgctaaacatgccttggaaaatcttaaattgaaaaagattttgatcatt
gactgggatgtgcaccatgggcaggggacacaacagatgttctacaacgaccctcgggtg
ctgtacttttccatacatcgatatgaattcgggaagttttggccaaatttacgagaaagt
gattatgacttcataggagaaggaaagggtgtggggtacaacataaatgtccctctgaac
cagataggaatggctgatcatgactacttagcaattttccatcaaattctcatgcctata
gcatctgagtttgacccagaacttgtgttgatttcggctggctatgattgtgcaataggt
tgtccagagtttgagcctgaattagtcattgtatcggccggttatgactctgctattgga
gatcctaaggggcagatgggtgtgaccccggcagcattcgctcaccttacccacaaggtc
atgtccttggctcaaggtcgtgtagctgttatcttggaggggggatactgtttgaaatct
ctaactgaatcagcagccatgaccctcagaacgttgcttggcgacccatgtcccagaatt
cctccttcacaggaaccatgtgacagtgttacagagtccatactgagcgtgatcaaggtg
ctgcgccctcactggaagtgcctgcagtatcagggattcacctctgacccttgcccttat
gaagaggtcaaccaattacctccaaagcctgatgttcaattcatggatgtggaaaataaa
ccgaaggaatacccagaatgcttggaaccgtacccggtggaggagtactatgaagaggac
aggaaatgctcacctattattgatagactcatagctaaaacgaacttagacaaggccaaa
catagaacctgcattgcctatgatgagggaatgagggcgcattataccagctcttcctac
taccaccctgaggccccagacaggataactcggatctttgacaagcacacagagtgggga
ctgacccagagatgcacaagggttgagacaaggatggcaacagaagcagaactggcttta
attcacagtaccacctacttgaatgagataaagagccttgaggacaaaaatccatttgag
ctgaagaaactggaaaggaagtttcagtccatctacctctgtcgggactcgtatttctgt
gcgcggatggccgccggatttgtgctggatgtggtggataacgtgatgaccgaacagagc
caaaatggagttgcaattgtgaggcccccgggacaccatgcagaatgcacggaggccatg
ggattctgcttctttaataacattgccattgctgccaaatacgcccagaacaaatacaat
gtcaaaaaagttctgattgtcgactgggatattcaccatggaaacgggacacagcggcag
ttttatgatgatccaagtgtactgtttattagcctccaccggtacgaccgtgggttcttc
tatccatcctcaccccagggctgccaaaccatggtggggaaaggggaggggacagggttc
aatgtcaacattgcatggaacaatggtcctatgggagactcagagtacattgctgcattc
cagcagatagtgatgcctatagcctatgagtttggtcctgaattggtactggtctctgct
ggatttgatgcagccttaggtgatcctttgggaaactacttagtgacacctctaggatat
ggtcacatgacacatatgttgtcttcattggccaatgggagagtgatcctagctttagag
ggagggtaccatatggcagccatagctaactcgatggcaatgtgtacctccattctcctg
ggagatgcctgtcctcaccttccttacacagagcctaaagacagtgctgttcaatgcatc
agagatgtcttagatgtacagaggaatcactggaagtcgttaaaattccgagtgaacata
aagacagaggaagataatgaggaagatcattttaaagcgaaagagagtcagaggaccatg
gaagatgaagaagatgaggagaagatgaatgagttggcaaagaaactaacagatattcaa
gtgacagaagatagcagcaatcccagagaagatgtagtggtccagaatagtgatggaagc
tcagagaaaagttctaaagaaatcatggatgaaatgaaagaacccatggaggcaagcact
aaaggggcagataaccctgtaacaaaaggagaaggtggtaaaaaacacactgttgaggga
gaggatccaggttctctctgtgcgaaaggaggggaggtacggggagcagagggagggaga
cagccctcagacgccacccctttgtcagccaatgatgttctcaaacagttagaaacccag
ggacacacccagatgtttgctgtgacccccctcccctggtgcccccacctagatacagtg
acccctgtccccaggggtcggattgatacaggtgccccctgtgaggagtgtggggatgtc
acagagaactggatctgcttggtctgttataaggttttctgtagccgctttgtcaatgaa
cacatgttgatgcacggggtgatggaggaacacctgatgtgtctcagcttctctgatctg
tccgtctggtgctacggctgtgaccattacatagacaatgtggccctgttccatgccaaa
aacgctgctcactgcgacaagtttgggagctccctccccacccctccatccctgtcccag
acctga

DBGET integrated database retrieval system