KEGG   Citrobacter rodentium: ROD_27101Help
Entry
ROD_27101         CDS       T01145                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
cro  Citrobacter rodentium
Brite
Enzymes [BR:cro01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     ROD_27101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2862527..2863174
Genome map
AA seq 215 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAELDYRLIKVDISKGNQFRPDFLSISPNNKIPAIVDRAP
ADGGAPLSLFESGEILLYLAEKSGMLLSGELRERHVTLQWLFWQVGGLGPMLGQNHHFNH
FAPQAIPYAIERYQVETQRLYNVLNKRLENSPWLGGEHYSIADIACWPWVHAHQRQRIDL
AMYPAVKNWYARIRSRPATERALLQAQLNPETLKG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctctattacgccccgacgcccaatggacacaagattacgctctttctggaa
gaagccgagctggactatcggttgataaaagtcgatatcagtaaaggtaatcagtttcgt
cccgattttttatccatttcccccaataataaaattcccgccattgtcgatcgtgcccct
gccgacggcggcgcgccgctcagcctttttgagtcgggcgagatcctgctgtatctggcg
gaaaagagcggcatgttactgagcggcgaactgcgcgagcgccacgtcaccttgcagtgg
ctgttctggcaggtcggcggtctggggccaatgctgggtcagaaccaccacttcaaccat
tttgccccgcaggccatcccctatgcgattgagcgttatcaggtcgaaacccagcgactg
tacaacgtcctgaacaagcggcttgaaaactcgccctggctgggcggcgaacattacagc
atcgccgatatcgcctgctggccgtgggttcacgcccatcagcgccagcgcatcgatctg
gcgatgtatccggcggtgaaaaactggtatgcgcgtatccgctcgcgcccggcaaccgaa
cgcgcgctgttgcaggcgcagcttaatcctgagacgttgaaagggtaa

DBGET integrated database retrieval system