KEGG   Chromohalobacter salexigens: Csal_3215Help
Entry
Csal_3215         CDS       T00347                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
csa  Chromohalobacter salexigens
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:csa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Csal_3215
Enzymes [BR:csa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Csal_3215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(3583014..3584303)
Genome map
AA seq 429 aa AA seqDB search
MELSRHEGQLPRITARYRIETPCDPERAAEAMAGEQSSGTFLKLAGETEALRERHAARVE
SVTCLKVGTTPSLPGALPGETYTSADVVLSWPLENIGTSLPNLLATVFGNLTELRELSGI
RLTDLVMPACFIEALPGPQFSIEGTRRLCGTEQGPLVGTIIKPSVGLTPEETATLVKQLI
EGGIDFIKDDELIADPPYSPLSERVPAIMQVINEHAQRTGRKPMYAFNITGDTDEMRHRH
DLVRDHGGTCVMASVNWIGLGALAALRRHSQLAIHGHRNGWGVFYRHPQLGISYRAYQAL
LRLAGADHLHVNGLASKFAEEDASVMDSARACLTPLLEGAERDDRAMPVFSSAQTVHQAC
PTFQQLQSTDLIYTCGGGIMAHPDGVAAGCRSIRAAWEAASIGVSLEDHAKQEPDLAVAL
RAFHSPFSG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggagttatcccggcatgaagggcaattgccacggatcactgcccgctatcgtatcgag
accccgtgcgaccccgaacgggctgccgaggcgatggccggcgaacaatcctccggcacg
ttcctcaagctggctggagagacagaggcgctgcgtgagcgccatgctgcccgggtcgag
tcggtgacctgtctgaaggtcggcaccacgccctccttgccgggggctctgcccggagaa
acctacacatctgccgatgtggttctgtcatggccactcgaaaacatcgggacaagtctg
cctaacttattggccacggtattcggcaacctcaccgagttgcgtgagctctctggcata
cgcctaacggatctcgttatgccggcttgctttatcgaagcattaccgggcccgcaattc
tccatcgaaggcactcgacgtctgtgcggtaccgagcagggccctttggtcggcaccatc
atcaagccgagcgtcgggcttaccccagaggaaacggcgacactggtcaaacagctcatc
gaagggggaatcgacttcatcaaggatgacgagttgattgccgatcctccctattcgcca
ttgagcgagcgagttcccgcgatcatgcaggtcatcaacgagcatgctcagcggaccggg
cgtaagccgatgtatgccttcaatatcacgggtgataccgacgagatgcgccatcgccac
gatctggtccgcgatcatggggggacgtgcgtcatggccagcgtcaactggatcggcctg
ggggcactggctgcgctgcgacgacactcgcaattggcaattcacggtcaccgcaacgga
tggggcgtgttttatcgtcatccacaactcggcattagctatcgcgcttatcaggctttg
ttgcgactggcgggggccgatcacctacatgtcaacggtctcgccagcaagttcgctgaa
gaggatgcatcggtcatggactccgctcgcgcctgccttacgccattgcttgagggagcg
gagcgcgatgaccgtgccatgccggtattttcttcggcgcaaaccgtccatcaagcatgc
cccaccttccaacagttgcagtcgaccgatctgatctacacctgcgggggaggcatcatg
gctcatcccgatggtgtcgccgcggggtgtcgcagcatacgtgctgcatgggaggccgca
tccattggtgtctccctagaggaccacgccaagcaggaacccgaccttgcggtcgcgttg
cgggcctttcacagcccgttttcaggatga

DBGET integrated database retrieval system