Chlorocebus sabaeus (green monkey): 103221354 Help Entry 103221354         CDS       T04361                                  Name (RefSeq) glutathione S-transferase A1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab00480   Glutathione metabolism csab00980   Metabolism of xenobiotics by cytochrome P450 csab00982   Drug metabolism - cytochrome P450 csab00983   Drug metabolism - other enzymes csab01100   Metabolic pathways csab01524   Platinum drug resistance csab05200   Pathways in cancer csab05204   Chemical carcinogenesis - DNA adducts csab05207   Chemical carcinogenesis - receptor activation csab05208   Chemical carcinogenesis - reactive oxygen species csab05225   Hepatocellular carcinoma csab05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     103221354   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     103221354    00982 Drug metabolism - cytochrome P450     103221354    00983 Drug metabolism - other enzymes     103221354  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103221354    05204 Chemical carcinogenesis - DNA adducts     103221354    05207 Chemical carcinogenesis - receptor activation     103221354    05208 Chemical carcinogenesis - reactive oxygen species     103221354   09162 Cancer: specific types    05225 Hepatocellular carcinoma     103221354   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103221354   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     103221354  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:csab02000]     103221354 Enzymes [BR:csab01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      103221354 Transporters [BR:csab02000]  Other transporters   Pores ion channels [TC:1]    103221354 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C GST_C_3 GST_N GST_N_3 GST_N_2 Motif Other DBs NCBI-GeneID:  103221354 NCBI-ProteinID:  XP_007970442 Ensembl:  ENSCSAG00000013074 UniProt:  A0A0D9RKW0 LinkDB All DBs Position 17:19726261..19743939 Genome browser AA seq 222 aa AA seqDB search MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEIYLKSAEDLDKLRNDGSLMFQQVPMVEI DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGIADLGEMILLLPICPPEEKDAK IALIKEKTKNRYFSAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL LKALKTRISNLPTVKKFLQPGSPRKPPMDAKSLEEARKIFRF NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atggcagagaaacccaagctccactacttcaatgcacggggcagaatggagtccacccgg tggctcctggctgcagctggagtagagtttgaagagatatatctaaaatctgcagaagat ttggacaagttaagaaatgatgggagtttgatgttccagcaagtgccaatggttgagatt gacgggatgaagctggtgcagaccagagccattctcaactacattgccagcaaatacaac ctctacgggaaagacataaaggagagagccctgattgatatgtatacagaaggtatagca gatttgggtgaaatgatcctccttctgcccatatgtccacctgaggaaaaagatgccaaa attgccttgatcaaagaaaaaacaaaaaatcgctacttctctgcctttgaaaaagtctta aagagccatggacaagactaccttgttggcaacaagctgagcagggctgacattcacctg gtggaacttctctactacgtggaagagcttgactccagccttatctccagcttccctctg ctgaaggccctgaaaaccagaatcagcaacctgcccacggtgaagaagtttctgcagcct ggcagccccaggaagcctcccatggatgcaaaatctttagaagaagcaaggaagattttc aggttttag

DBGET integrated database retrieval system