KEGG   Chlorocebus sabaeus (green monkey): 103226145Help
Entry
103226145         CDS       T04361                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  
glucokinase [EC:2.7.1.2]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Insulin secretion
Prolactin signaling pathway
Glucagon signaling pathway
Type II diabetes mellitus
Maturity onset diabetes of the young
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:csab00001]
   00010 Glycolysis / Gluconeogenesis
    103226145 (GCK)
   00052 Galactose metabolism
    103226145 (GCK)
   00500 Starch and sucrose metabolism
    103226145 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    103226145 (GCK)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103226145 (GCK)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    103226145 (GCK)
   04910 Insulin signaling pathway
    103226145 (GCK)
   04922 Glucagon signaling pathway
    103226145 (GCK)
   04917 Prolactin signaling pathway
    103226145 (GCK)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    103226145 (GCK)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103226145 (GCK)
   04950 Maturity onset diabetes of the young
    103226145 (GCK)
Enzymes [BR:csab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     103226145 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
21
AA seq 466 aa AA seqDB search
MAMDATRSQAQTALTLVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLP
TYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTA
EMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGN
NVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQ
NVELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKYMG
ELVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYNILSTLGLRP
SATDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSF
KEQFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKACMLGQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggatgccacaaggagccaggcccagacagccttgactctggtagagcagatc
ctggcggagttccagctgcaggaggaggacctgaagaaggtgatgagacggatgcagaag
gagatggaccgtggcctgaggttggagacccatgaagaggccagtgtgaagatgctgccc
acctacgtgcgctccaccccagaaggctcagaagtcggggacttcctctccctggacctg
ggtggcaccaacttcagggtgatgctggtgaaggtgggagaaggtgaggaggggcagtgg
agcgtgaagaccaaacaccagatgtactccatccccgaggacgccatgaccggcactgct
gagatgctcttcgactacatctccgagtgtatctccgacttcctggacaaacatcagatg
aagcacaagaagctgcccctgggcttcaccttctcctttcctgtgaggcatgaagacatc
gataagggcatccttctcaactggaccaagggcttcaaggcctcaggagcagaagggaac
aatgtcgtggggcttctgcgagacgccatcaaacggagaggggacttcgaaatggatgtg
gtggcaatggtgaatgacacggtggccacgatgatctcctgctactacgaagaccatcag
tgcgaggtcggcatgattgtgggcacgggctgcaacgcctgctacatggaggagatgcag
aatgtggagctggtggagggagacgagggccgcatgtgcgtcaacaccgaatggggcgcc
ttcggggactcgggcgagctggacgagttcctgctggagtatgaccgcctggtggacgag
agctctgcaaaccccggtcagcagctgtatgagaagctcataggtggcaagtacatgggc
gagctggtgcggctcgtgctgctcaggctcgtggacgaaaacctgctcttccacggggag
gcctccgagcagctgcgcacacgcggagccttcgagacacgcttcgtgtcgcaggtggag
agcgacacgggcgaccgcaagcagatctacaacatcctgagcacgctggggctacgaccc
tcggccactgactgcgacatcgtgcgccgcgcctgcgagagcgtgtctacgcgcgctgca
cacatgtgctcggcggggctggcgggcgtcatcaaccgcatgcgcgagagccgcagcgag
gatgtaatgcgcatcactgtgggcgtggatggctccgtgtacaagctgcaccccagcttc
aaggagcagttccacgctagcgtgcgcaggctgacgcccagctgcgagatcaccttcatc
gagtcggaggagggcagtggccggggcgcggccctggtctcggcggtggcctgtaagaag
gcctgcatgctgggccagtga

DBGET integrated database retrieval system