KEGG   Chlorocebus sabaeus (green monkey): 103227060Help
Entry
103227060         CDS       T04361                                 

Gene name
PRSS2
Definition
(RefSeq) protease, serine 2
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:csab00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103227060 (PRSS2)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    103227060 (PRSS2)
   04974 Protein digestion and absorption
    103227060 (PRSS2)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    103227060 (PRSS2)
Enzymes [BR:csab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     103227060 (PRSS2)
Peptidases [BR:csab01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103227060 (PRSS2)
Exosome [BR:csab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103227060 (PRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
21
AA seq 295 aa AA seqDB search
MQDPGKGKAAGVFVLGGAVTLTSQTLPLPILGRYKDGSSATSQAHSTTMNPLLILTFVGV
AVAAPIDDDDKIVGGYTCEENSVPYQVSLNSGYHFCGGSLISKQWVVSAAHCYKTRIQVR
LGEHNIEVLEGTEQFINAAKIIRHPNYNSRTLDNDILLIKLSSPAVINARVSTISLPTAP
PAAGAEALISGWGNTLSSGADYPDELQCLEAPVLSQAACEASYPGRITSNMFCVGFLEGG
KDSCQGDSGGPVVSNGQLQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaccctgggaaggggaaagctgcaggtgtgtttgtgctgggaggagcagtgacc
ctcacctcacagacacttcctctcccaatcctcgggaggtataaagacgggtcctctgcc
accagtcaggcacattctaccaccatgaatccactcctgatccttacctttgtgggagtt
gctgttgctgcccccattgacgatgatgacaagattgttgggggctacacctgtgaggag
aattctgtcccctaccaggtgtctctgaattctggctaccacttctgtggtggttccctc
atcagcaaacagtgggtggtgtcagcagctcactgctacaagacccgcatccaggtgaga
ctgggagagcacaacatagaagtcctggaggggactgagcagttcatcaatgcagccaag
atcatccgccaccccaattacaactcgaggactctggacaatgacatcctgctgatcaag
ctctcctcacctgccgtcatcaatgcccgcgtgtccaccatctctctgcccaccgcccct
ccagctgctggtgccgaggccctcatctctggctggggcaacactctaagctctggcgcc
gactacccagatgagttgcagtgcctggaagcgcctgtgctgtcccaggctgcgtgtgaa
gcctcctaccctggaaggattaccagcaacatgttctgtgtgggcttccttgagggaggc
aaggattcctgccagggtgactctggtggccctgtggtctccaatggacagctccaagga
attgtctcctggggctatggctgtgcccagaagaacaggcctggagtctacaccaaggtc
tacaactatgtggactggattaaggacaccatagctgccaacagctaa

DBGET integrated database retrieval system