KEGG   Chlorocebus sabaeus (green monkey): 103234325Help
Entry
103234325         CDS       T04361                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
csab  Chlorocebus sabaeus (green monkey)
Brite
Enzymes [BR:csab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     103234325 (TMPRSS9)
Peptidases [BR:csab01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103234325 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Ldl_recept_a SEA Trypsin_2
Motif
Other DBs
NCBI-GeneID: 103234325
NCBI-ProteinID: XP_007994231
LinkDB All DBs
Position
6
AA seq 887 aa AA seqDB search
MESTVADVHLMPRTTKEVPTPDAACCRVVTIGVVATSLVILTLGVLLAFLSTRGVHVDHT
AELRGIRWASSLRREASDYHRTLTPTLEALFVSSFQKTELEASCVGCTVLNYRDGNSSVL
VHFQLHFLLRPLQTLSLGLEEELLQRGIQARLRERGISLAAYGTIVSAELTGRHKGPVAE
RDLKSGRCPGNSFSCQNSQCVTKVNPECDDREDCSDGSDEVHCECGLQPAWRMAGRIVGG
VEASPGEFPWQASLRENKEHFCGATIISARWLVSAAHCFNDLPVAQAGVAAMLAAGETEG
GSERRCPSASQLKVAARAPALSPCFSLPIGPVVKPEVLQKATVELLDQALCASLYGHSLT
DRMLCAGYLDGKVDSCQGDSGGPLVCEEPPGRFFLAGIVSWGIGCAEARRPGVYARVTKL
RDWILEATTRASMPLAPTVAPAPTASSTTWPTSPESPVVNTPTKSTQAPSTVPLDWVTVP
KLQGIFGAERKKMMYAPIYLDLGRIDIFIVGDSGGPLACEEAPGVFYLAGIVSWGIGCAQ
VKKPGVYTRITRLKGWILEIMSSQPLPVSPPSTTRTLATTSHPPRTTAGLTVLGATPSRP
TPGAASRVTGQPANSALSAMSTTARGQMPFPDVLEATTHSQLPDCGLAPAALSRIVGGSA
AGRGEWPWQVSLWLRRREHRCGAVLVAERWLLSAAHCFDVYGDPKQWAAFLGTPFLSGAE
GQLERVARIYKHPFYNLYTLDYDVALLELAGPVRRSRLVRPICLPEPVPRPPDGARCVIT
GWGSVREGGSMARQLQKAAVRLLSEQTCRRFYPVQISSRMLCAGFPQGGVDSCSGDAGGP
LACREPSGRWVLTGVTSWGYGCGRPHFPGVYTRVAAVRGWIGQHIQE
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atggagtctactgtggctgacgtacacctcatgcccaggacaaccaaggaagtccccact
ccagacgctgcgtgctgtcgagtggtcaccattggtgtggtggccaccagccttgtcatc
ctcaccctgggagtccttttggccttcctgtctacacggggcgtccacgtggaccacacg
gccgagctgcggggaatccggtgggccagcagtttgcggcgggaggcctcggactatcac
cgcacactgacgcccaccctggaggcactgtttgtaagtagttttcagaagacagagtta
gaggcaagctgtgtgggttgcacggtgctgaattacagggatgggaactccagtgtcctc
gtacatttccagttgcacttcctgctgcgacccctccagacgctgagcctgggcctggag
gaggagctgttgcagagagggatccaggcaaggctgcgagagcgcggcatctccctggct
gcctatggcacaattgtgtcggctgagctcacaggaagacataaggggcccgtggcagaa
agagatttaaaatcaggccgctgcccagggaactccttttcctgccagaacagccagtgt
gtgaccaaggtgaacccggagtgtgacgaccgggaggactgctccgatgggtccgatgag
gtgcactgtgagtgtggcttgcagcctgcctggaggatggccggcaggatcgtgggcggt
gtggaagcgtccccgggggagtttccatggcaagccagccttcgagagaacaaggagcac
ttctgtggggccaccatcatcagtgccaggtggctggtgtctgccgctcactgcttcaat
gatttgcctgttgcccaggctggagtggcggccatgcttgcagctggggaaactgaggga
ggctcggagaggagatgtccttcagcctcccagctcaaagtggctgccagggctccggca
ctctcaccctgcttttctctccccatcgggccagtggtcaagccagaggtgctgcagaaa
gccactgtggaactgctggaccaggcactgtgtgccagcctgtacggccactcactcact
gacaggatgttgtgcgctggctacctggatgggaaggtggactcctgccagggcgactca
ggaggacccctggtctgcgaggagccccctggccggttctttctggccggcatcgtgagc
tggggaattggctgtgcagaagcccggcgtccgggggtctatgcccgagtcaccaagcta
cgtgactggatcctggaggccaccaccagagccagcatgcctctggcccccacggtggct
cctgcccccaccgcctccagcacgacctggcccaccagtcctgagagccctgtggtcaac
acccccaccaaatccacgcaggcccccagcactgtgcctcttgactgggtcaccgttcct
aagctacaaggtattttcggggcagaaaggaagaagatgatgtacgcgcctatctatctt
gatttagggagaattgatatcttcatagtaggtgactctgggggccccctggcctgtgag
gaggcccccggcgtgttttatctggcagggatcgtgagctggggtattggctgcgctcag
gttaagaagccgggcgtctacacgcgcatcaccaggctaaagggctggatcctggagatc
atgtcctctcagccccttcccgtgtctcccccctcgaccacaaggacactggccaccacc
agccatccccccaggacgacagctggcctcacggtcctgggggccacacccagcagaccc
acccctggggccgccagcagggtgacgggccaacctgccaactcagccttatctgccatg
agcaccactgctaggggacagatgccatttccagatgtcctggaggccaccacgcactcc
cagctaccagactgcggcctggcgccggcggcgctcagcaggattgtgggcggcagcgca
gcgggccgcggggagtggccgtggcaggtgagcctgtggctgcggcgccgggaacaccgc
tgcggggccgtgctggtggcagagaggtggctgctgtcagcggcgcactgcttcgacgtc
tacggggaccccaagcagtgggcggccttcctaggcacgccgttcctgagcggcgcggag
gggcagctggagcgcgtggcgcgcatctacaagcacccgttctacaatctctacacgctt
gactacgacgtggcgctgctggagctggcggggccggtgcgccgcagccgcctggtgcgc
cccatctgcctgcccgagcccgtgccgcgacccccagacggtgcgcgctgcgtcatcacc
ggatggggctcggtgcgcgaaggaggctccatggcgcggcagctgcagaaggctgccgtg
cgcctcctcagcgagcagacctgccgccgcttctacccggtgcagatcagcagccgcatg
ctgtgtgccggcttcccgcagggcggcgtggacagctgctcgggtgacgctgggggaccc
ctggcctgcagggagccgtctggacgatgggtgctaactggggtcaccagctggggctat
ggctgcggccggccccacttcccaggtgtctatacccgggtggcagctgtgagaggctgg
ataggacagcacatccaggagtga

DBGET integrated database retrieval system