KEGG   Chlorocebus sabaeus (green monkey): 103242720Help
Entry
103242720         CDS       T04361                                 

Gene name
LIG3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  
DNA ligase 3 [EC:6.5.1.1]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
Base excision repair
Module
BER complex
Brite
KEGG Orthology (KO) [BR:csab00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    103242720 (LIG3)
Enzymes [BR:csab01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103242720 (LIG3)
DNA repair and recombination proteins [BR:csab03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     103242720 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
16
AA seq 1009 aa AA seqDB search
MSLAFKIPFPQTLRALSRKELYLFREHHRPDVRQFSQWSETDLLHGHPLFLRRKPVLSFQ
GSHLRSRATCLVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGICRIG
KVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQH
IADLSSKAASTPKKKAVVQAKLTTTGQVTSPVKSTSFVTNNNPRKFSGFSAKPNNSGEAP
SSPTPKRSLSSSKCDPKHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFH
GDVYLTVKLLLPGVVKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQ
SKSFPPAAKSLLTIQEVDEFLLRLSRLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDL
KMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQEVEKEPGQRRALSVQASLMTP
VQPMLAEACKSIEYAMKKCPNGMFAEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAH
FKDYIPQAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYF
NDVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKRVTKASDLADMITRVIREGLEGLVLK
DVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPGS
QKWCTVTKCAGGHDDATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPDFIVPDPKKAA
VWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTV
VAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKGGNMLTVKPS
AVKVGEKLAMKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFV
AFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPC
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgtctttggctttcaagatcccctttccacaaaccctccgtgcactcagccgaaaagaa
ctgtacctattccgagaacatcacaggcctgatgtaagacaattcagccagtggtcagaa
acagatctgcttcatggacaccccctcttcctgagaagaaagcctgttctgtcattccag
ggaagccatctaagatcacgtgccacctgccttgttttcttgccagggttgcatgtggga
ctctgcagtggcccctgtgagatggctgagcaacggttctgtgtggactatgccaagcgt
ggcacagctggctgcaaaaaatgcaaggaaaagattgtgaagggcatatgccgaattggc
aaagtggtgcccaatcccttctcagagtctgggggtgatatgaaagagtggtaccacatt
aaatgcatgtttgagaaactagagcgggcccgggccaccacaaaaaaaatcgaggacctc
acagagctggaaggctgggaagagctggaagataatgagaaggaacagataacccagcac
attgcagatctgtcttctaaggcagcaagtacaccaaagaagaaagctgttgtccaggct
aagttgacaaccactggccaggtgacttctccagtgaaaagcacctcatttgtcaccaat
aacaatccccggaaattttctggcttttcagccaagcccaacaactctggggaagccccc
tcaagccccacccctaagagaagtctgtcttcaagcaaatgtgaccccaagcataaggac
tgtctgctacgggagtttcgaaagttatgcgccatggtggccgataatcctagctacaac
acgaagacccagatcatccaggacttcctgcggaaaggctcagcaggagatggtttccac
ggtgatgtgtacctaacggtgaagctgctgctgccaggagtcgttaagactgtttacaac
ttgaatgataagcagattgtgaagcttttcagtcgcatttttaactgcaacccagatgat
atggcacgggacctagagcagggtgacgtgtcagagacaatcagagtcttctttgagcag
agcaagtctttccccccagctgccaagagcctccttaccatccaggaggtggatgagttc
cttctgcggctgtccaggctcaccaaggaggatgagcagcaacaggccctgcaggacatt
gcctccaggtgtacagccaatgaccttaaatgcatcatcaggttgatcaaacatgatctg
aagatgaactcaggtgcaaaacatgtgttagacgcccttgaccccaatgcctatgaagcc
ttcaaagcctcgcgcaacctgcaggatgtggtggaacgggtccttcacaatgctcaggag
gtggagaaggagccgggccagagacgagctctgagcgtccaggcctcgctgatgacaccc
gtgcagcccatgctggcggaggcctgcaagtccattgagtacgcaatgaagaaatgtccc
aatggcatgttcgctgagatcaagtacgatggagagcgagtccaagtgcataagaatgga
gaccacttcagctacttcagccgcagtctcaagcccgtcctgcctcacaaggtagcccac
tttaaggactacatcccccaggcttttcctgggggacacagcatgatcttggattctgag
gtgcttctgattgacaacaagacaggcaaaccactgccctttgggactctgggagtgcac
aagaaagcagccttccaggatgctaatgtctgcctgtttgtttttgattgtatctacttt
aatgatgtcagcttgatggacaggcctctgtgtgagcggcggaagtttcttcatgacaac
atggttgaaattccaaaccggatcatgttttcagaaatgaagcgagtcacaaaagcttcg
gacttggctgacatgataacccgggtgatccgggagggattggaggggctggtgctgaag
gatgtgaagggtacatatgagcctgggaagcggcactggctgaaagtgaagaaggactat
ttgaacgagggggccatggccgacacagctgacctggtggtccttggggccttctatggc
caagggagcaaaggcggcatgatgtcaatcttcctcatgggctgctacgaccctggcagc
cagaagtggtgcacagtcaccaagtgtgcaggaggccatgatgacgccacgcttgcccgc
ctgcagaatgaactagacatggtgaaaatcagcaaggaccccagcaaaatacccagctgg
ctgaaagtcaacaagatctactatcctgacttcatcgtcccagacccaaagaaagctgcc
gtgtgggagatcacaggggctgaattctccaaatcggaggctcacacagctgatgggatc
tccatccgattccctcgctgcacccgaatccgagatgataaggactggaaatctgccact
aaccttccccaactcaaggaactgtaccagttgtccaaggagaaggcagacttcactgta
gtggctggagatgaggggagctccactacagggggtagcagtgaagagaataagggtccc
tcagggtctgctgtgtcccgcaaggcccccagcaagccctctgccagtaccaagaaagca
gaagggaagctgagtaactccaacagcaaaggcggcaacatgctgactgtaaagccttct
gctgtgaaggtgggagagaagctggccatgaagtcttctccagtgaaagtaggggagaag
cggaaagctgctgatgagaccctgtgccaaacaaaggttctgctggacatcttcactgga
gtgcggctttacttgccaccctccacaccagacttcagccgtctcagacgctactttgtg
gcattcgacggggacctggtacaggaatttgatatgacctcagccacgcacgtgctgggt
agcagggacaagaaccctgcggcccagcaggtctccccagagtggatttgggcatgtatc
cggaaacggagactggtagctccctgctag

DBGET integrated database retrieval system