KEGG   Camelina sativa (false flax): 104713396Help
Entry
104713396         CDS       T05044                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH2 isoform X1
Organism
csat  Camelina sativa (false flax)
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-CW TILa
Motif
Other DBs
NCBI-GeneID: 104713396
NCBI-ProteinID: XP_010428800
LinkDB All DBs
Position
9
AA seq 1799 aa AA seqDB search
MDCKENGISGSLSGDLNANSLGLKSPPSFSGLNLDSVTSLETPQVASVVKSTKEGQRKCF
IDSERMGDENSNSKEHTGNSDDGLDFCCDAEDTQKQGVVSDEVEQTQQFICDADLLVDCN
KPDDGKESQDTKLSLVSIVSGDMQQEGAPQAIEDEGYGGTIFPIEDNGIENESNFLNDDV
PEQMGSLETAKHRNPGEVGSDGISSTFDAGDKEGRNEPSSDHDSGSSDDISFFQSCPFPD
TIMDSGLFGCSPAEDYLNDSSEIEGNLPIVVSPSLAITEMLSNSDGGRCSYDLDDIVNTE
TVEPDLKLGQQDELHTDLSEKNEKMQKDHVGVSSIDSDVAALSMNNGIAADLRAEIFNQI
SPINENTLGIEANSHITDSSLMWNFPSNFGNGDIEVCNPDNAVEPLRIVDGNGRIGGEVA
SASGTNFCEIGLSSSRRKSRNGKQGKMAQTKRSAPHPRKSSRKKQSAGDLDSVFKCSKQK
RSSLLKISRSSEWGLPSRTTEIFLQSNNIPCDGPPHHDAQKSQSNPKNGEYNRSSNNGYV
EGSNKNIQASSGLRLKVKFGGGQNPMNITFSKVSANSFPANGIVKAGSGLELPGSTNFAV
DNLRTGETKEDLEEKNNLVEKVPYLQSSDFMRDEKQDDGGFCRKPGGDVLDDDPHLSTSI
MVEECERATGTRNLDAETSPDSEVINSVPDSIVNIEQKGDLHHGVYSAPEDVVGKNRGLE
KKDKLSASKSLLENGSHLIPSAKKGKDAKSKRKGTKKGKSKLSESAKDGRKNESHEGVEQ
RQSMNSSNERVDSDHLEVGGIESHKTTGALLDADIGKTSAINGTISSDVNLGEMVVDGTI
EDNSSSESAWVRCDDCYKWRRIPASVVGSIDESSRWICRNNSDTKFADCSKSQEMSNEDI
NEELGIGQEEADAYDCDLAKRGKEKEQKSKRLTGKQKACFKAIKTNQFLHRNRKSQTIDE
IMVCHCKPPPDGRLGCGEECLNRMLNIECLPSTCPAGELCSNQQFQKRKYVKFERFQSGK
KGYGLRLLEDVREGQFLIEYVGEVLDMQSYESRQKEYACKGQKHFYFMTLNGNEVIDAGA
KGNLGRFINHSCEPNCRTEKWMVNGEICVGIFSMQDLKKGQELTFDYNYVRVFGAAAKKC
YCGSSHCRGYIGGDPLNGDVIIQSDSDEEYPELVILEEDESGEGILDATSKTFIDDVDEQ
MPQNSEMVNGSKDHAPDNAELQSSVSSQLPEREILPPLQPTGVLKELWSDTPVSSVRQEA
HVEKKTKSTSPTSNSLSRLSSDGANADKMTKHGSGEDKKILPRPRPRMKTSRSSGSSKRD
KGGSLPGVNKAQVIPVSKLQQQPIKPKGSEEVSPSGRVETFEGKLNELLDVAGGISKRRD
SAKGYLKLLLLTAASRGTNNEGIQSNRDLSMILDALLKTKSKSVLVDVINKNGLQMLHNI
MKQYRSDFKKTPILRKLLKVLEYLATREILALEHIIRRPPCAQMESFKDSILSFTEHEDK
QVHQIARNFRDRWIPKPFRKPWRINREERSESMRSPRNNRFRASQEPKYNHQSPRPGEPV
ASVITSMATTPETASVSEGYSEPNSSLPETNGRKRKSRWDQPSISKEQRTSQQTVETNGN
QDVQDDLPPGFTSPCTDVPDAITAKPQQKFLSRLPVSYGIPLSIVHQFGSPGKEDPTTWS
VAPGMPFYPFPPLPPVSHGEFFAKRNGTVCSSSMGNPTCSIETLPAITEPNQSCCNTSSI
AVNDSPAPNRKREFSSDIGTSYFRQQKQNIPPWMRNNGWEKTANSPIPGNLTVEKKLNN
NT seq 5400 nt NT seq  +upstreamnt  +downstreamnt
atggattgtaaggagaacggtattagtggctctctttctggcgatttgaatgctaattct
ctgggtttaaagtctccaccgagtttttctgggctcaatttagattcagtcactagtttg
gagactcctcaggttgcatcagttgtaaagtcaacaaaggagggtcaaaggaagtgcttt
atagatagcgagagaatgggagatgaaaacagtaactctaaagaacatactgggaactct
gatgatggtttagatttttgttgcgacgctgaagacactcagaagcagggagtggtttca
gatgaggttgaacaaactcaacaattcatttgtgatgctgatttactggtagactgcaac
aagccggatgatggaaaggagagtcaggacaccaaattatcccttgtatccattgtttct
ggggatatgcaacaggaaggagctcctcaggctatagaagatgaagggtatggtggcaca
atatttcctatagaggacaatggaatagagaatgaatcgaatttcttgaatgatgatgta
ccagaacaaatggggtctttggaaaccgcaaagcacagaaaccctggtgaagttggaagc
gatggtattagctctacctttgatgctggagataaggaaggaagaaatgaaccatcgagt
gatcatgattctggttcttctgatgatatatcattctttcagagttgtccgtttccagat
acgataatggactctggtttatttggctgtagccctgcagaagattatctgaatgattca
agtgaaattgaaggcaatctgcctattgtggtatccccttcattagctattacagaaatg
ttaagtaatagtgacggtggccgatgttcatatgatctagatgacatcgtaaacacagag
acagtcgaaccagatttgaagctgggacagcaggatgagcttcacactgatctttccgag
aagaatgaaaagatgcaaaaggatcatgttggggtttcatcaattgatagtgatgtggcc
gctttgagtatgaataatggtatagctgctgatctgagagctgaaattttcaatcagata
tcacccataaacgaaaatactttaggtattgaagccaactcccatattactgactcttct
ttgatgtggaattttccatcgaactttggaaatggagacatcgaagtctgtaatcctgac
aatgcagttgagccactcagaatagtggatggcaatggcagaataggtggtgaagttgct
tctgcatcagggactaatttttgtgaaattggcttgtcttcatcccgtaggaagtcccga
aatggtaaacagggtaaaatggcgcagacaaaaaggagtgccccccatccgagaaagtcc
tctagaaagaaacaatcagcaggagaccttgattcagtttttaagtgctcaaagcagaag
aggagctctcttttaaaaataagccgttcatctgagtggggattgcctagcaggaccact
gaaatcttcttacagagcaataatattccctgtgatggacctccgcatcatgatgcacag
aaatctcagagcaatcctaagaatggagagtataataggagttctaataacggatatgta
gaaggatctaacaaaaacatccaagcatcaagtggccttcgtttgaaagttaaatttggt
ggtggccaaaatcctatgaacattacattctctaaggtcagtgctaactcttttcctgct
aatggtattgttaaggcaggatcaggtttagaattgccaggatcaacaaattttgctgtg
gataatctgcgaactggggaaactaaagaggatttggaagagaaaaacaaccttgtggag
aaagttccatatctgcagtcatctgattttatgagggatgagaaacaagacgatgggggg
ttttgtaggaagccgggtggtgatgttttagatgatgacccacacctttccactagtata
atggttgaagagtgcgagagggccactgggacgcgaaacctagatgctgaaacttcacca
gattccgaagttatcaactctgtgcctgattcgattgtcaatattgaacagaaaggggat
ttgcatcatggtgtttacagcgctccagaagatgtggtcggcaagaacagaggattagaa
aaaaaagataaattgtctgcttcaaaatctcttttggaaaatggttcacatctaattccc
agtgctaaaaagggtaaagatgctaagtctaaaaggaaaggaacaaagaaagggaaatcc
aagctttctgaatctgctaaagacgggagaaaaaatgaatctcatgagggagtagagcaa
cgtcaatccatgaatagcagtaatgaaagggttgatagtgatcatcttgaagtaggggga
atagagtctcacaagacaacaggtgctcttctagatgcagatattgggaaaaccagtgcc
attaatggtaccatatcatcagatgtgaaccttggggaaatggttgtggacggtactatt
gaggataactcttcctcagagagtgcttgggttcgatgtgatgattgctataaatggcga
cggatacctgcttctgttgtaggatcaattgacgagagctccagatggatctgtaggaac
aactcagatacaaaatttgcggattgctcaaaatctcaagagatgtcaaatgaagatatt
aatgaagagttgggcataggacaggaggaagcagatgcatatgattgtgatttggctaaa
agagggaaagaaaaggaacagaagagcaagcgtttgacaggtaagcaaaaggcgtgcttc
aaggctataaaaactaaccagtttcttcatcgcaatcgtaaatctcaaacaattgacgag
ataatggtttgtcattgcaaaccaccacctgatggtaggttgggttgtggagaagaatgc
ctcaatagaatgcttaacattgaatgtcttcccagtacgtgcccggctggcgaattgtgt
tcaaatcagcagtttcaaaaacggaagtatgttaagtttgagagattccaatctggtaag
aagggttatggcctgagattgctcgaagatgtacgagagggacaattccttattgagtat
gttggagaggtgcttgatatgcaatcctacgagtctcgccaaaaagaatatgcttgcaag
ggtcagaaacatttctatttcatgacactgaatgggaatgaggtaatagatgctggtgct
aagggaaatttagggcgtttcattaaccatagctgtgaaccaaactgtcgtactgaaaag
tggatggtgaatggtgaaatttgcgttggaatattctccatgcaagaccttaagaagggt
caagagttgacatttgactacaactatgtgagggtttttggtgctgctgccaaaaagtgc
tattgcggatcatcacattgccgagggtatattgggggggatcccctgaacggtgatgta
attattcaaagtgattcagatgaagagtatcctgaacttgtgatccttgaagaagatgaa
agtggggaaggaatcttagatgcaacatctaagaccttcattgatgacgttgacgagcaa
atgccacagaactctgaaatggttaatggttccaaggaccatgctcctgataatgccgaa
ttacagagctcggtatcttcacaacttccagagcgagaaattcttccacctcttcagcca
actggagttttgaaggaactttggtcagacacgcctgttagttctgtccggcaggaggct
catgttgaaaagaagactaaaagcacatctcccacgtccaattctcttagcagactgtcc
tcggatggtgcaaatgctgataagatgacaaagcatggatcgggggaagataaaaagata
cttccacgaccccgtcctcgtatgaaaacttctcgttcatctgggtcgagtaagcgagac
aaaggaggtagtcttcctggtgttaacaaagcacaggttataccagtgagtaagttgcaa
caacagcccatcaaacctaaaggatcagaggaagtttctcccagcggacgtgttgaaaca
tttgaagggaaactgaacgagttactagatgttgcgggagggataagcaagcggagggat
tcagcaaaaggctacttaaaacttctgcttctcactgccgcttcccgaggcacgaataat
gaaggaattcaaagcaatcgagatctttcaatgattcttgatgcccttttgaagacaaag
tcaaaatctgttttagtggatgtaatcaacaagaatggtctgcaaatgttacataatatc
atgaaacaataccggagtgattttaaaaagacccctatactccggaaacttctgaaggta
ttagagtatcttgctacaagggaaatccttgcactggagcatataatcagaaggcctccg
tgtgcacagatggaaagctttaaggattctattctatctttcactgagcatgaggacaaa
caggttcatcaaattgcacggaacttccgagacagatggatccctaaaccttttagaaaa
ccttggcgcatcaacagggaggagagatctgagtctatgaggtcacctagaaacaacagg
ttcagagcatcacaagaacctaaatataatcatcagtccccaagacctggagaaccagtt
gcgtctgtcataacatcaatggctacaactcctgaaacagcatctgtatctgagggatat
tcagaacctaattccagtctccctgagacaaatggacgcaagcgcaaaagcagatgggac
cagccatctatatccaaagaacaaagaacgtctcagcaaactgttgaaactaatggaaat
caggatgtccaagatgaccttccacccgggtttacatcaccttgcacggatgtgcctgat
gcaattactgcgaagccgcaacaaaagttcctttctcggttaccggtatcctatggtatt
ccacttagcattgttcatcaatttggttcacccggcaaagaggacccgaccacctggtct
gttgctcctggcatgccgttctatccatttccacctctacccccagtgtctcatggtgag
ttttttgccaagagaaacggaacagtctgttcctcctccatgggaaacccgacttgctcc
attgagaccttaccggctataactgaacccaaccaatcctgttgtaacacctcaagtatt
gccgtgaatgactcacccgctccaaaccggaagagagagttttcatccgatataggaaca
agttattttcggcaacagaaacagaacattcccccatggatgcggaacaatgggtgggaa
aaaacagcaaacagccctatacctggaaatttaactgtagagaagaagctcaacaattaa

DBGET integrated database retrieval system