KEGG   Camelina sativa (false flax): 104719509Help
Entry
104719509         CDS       T05044                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain F1, chloroplastic-like isoform X1
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
csat  Camelina sativa (false flax)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:csat00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    104719509
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104719509
Enzymes [BR:csat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     104719509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
10
AA seq 181 aa AA seqDB search
MASSMLSSAAVVTTPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWP
PIGKKKFETLSYLPDLTDVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGR
YWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKPPSFTG
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctatgctctcctccgctgctgtggttaccaccccagctcaagccaccatg
gtcgctccattcaccggcttgaagtcatccgctgctttccccgtcacccgcaaggccaac
aacgacattacttccatcgcaagcaacggcggaagagttagctgcatgaaggtgtggcca
ccaattggaaagaagaagtttgagactctatcttaccttcctgaccttaccgatgtcgaa
ttgggtaaggaagttgactaccttctccgcaacaagtggattccttgtgttgaattcgag
ttggagcacggatttgtgtaccgtgagcacggaagcacacccggatactacgatggacgg
tactggacaatgtggaagcttccattgttcggatgtactgactccgctcaagtgttgaag
gaagtggaagagtgcaagaaggagtaccctaacgccttcattaggattatcggattcgac
aacacccgtcaagtacaatgcatcagtttcatcgcctacaagcccccaagcttcaccggt
gcttaa

DBGET integrated database retrieval system