KEGG   Camelina sativa (false flax): 104726917Help
Entry
104726917         CDS       T05044                                 

Definition
(RefSeq) histone deacetylase 6
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
csat  Camelina sativa (false flax)
Brite
Enzymes [BR:csat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     104726917
Chromosome [BR:csat03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     104726917
   HDAC complexes
    Sin3A-HDAC complex
     104726917
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    104726917
  Chromatin remodeling factors
   NuRD complex
    104726917
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
2
AA seq 472 aa AA seqDB search
MEADESGISLPSGPDGRKRRVSYFYEPTIGDYYYGQGHPMKPHRIRMAHSLIIHYHLHRR
LEISRPNLADASDIGRFHSPDYVDFLASVSPESMGDPSSARNLRRFNVGEDCPVFDGLFD
FCRSSAGGSIGAAVKLNRQDADIAINWGGGLHHAKKSEASGFCYVNDIVLGILELLKMFR
RVLYVDIDVHHGDGVEEAFYTTDRVMTVSFHKFGDFFPGTGHIRDVGAENGKYYALNVPL
NDGMDDESFRSLFRPLIQKVMEVYQPEAVVLQCGADSLSGDRLGCFNLSVKGHADCLRFL
RSYNIPLMVLGGGGYTIRNVARCWCYETAVAVGVEPDNNLPFNEYFEYFGPDYTLHVDPG
PMENLNTPKDMEKIRNTLLEQLSGLMHAPSVQFQHTPPVNRVLDEPEEDMETRPKPRIWS
GTAAYESDSDDDDKPLHGLSGLDGPAMDRDSTGEDEMEDDDNPEPDVTPPSS
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagacgagagcggtatctccttgccgtcaggacccgacggtcgtaagcggcga
gtcagttacttctacgagccaacgatcggtgactactactacggtcaaggacatccgatg
aaacctcaccggatccgtatggctcatagcctaatcatccactatcatctccaccgtcgc
ttagaaatcagccgtcctaacctcgccgacgcctccgatatcggccgctttcattccccc
gattatgttgatttcctcgcttccgtttcgccggaatctatgggcgatccttcctctgca
cgaaacctaaggcgattcaatgtcggcgaggactgtcctgtcttcgacgggctttttgat
ttttgccgttcttccgccggtggttccattggcgccgccgtcaagttaaacaggcaggac
gctgatatcgctatcaattggggcggtgggcttcaccatgccaagaaaagcgaggcctct
gggttttgctatgttaatgacatcgttcttgggattcttgagttgctcaagatgtttagg
cgggttctctacgtagacatcgatgtccatcatggagatggagtggaagaagcgttttac
accactgatagagtgatgactgtttctttccacaaatttggggactttttcccaggaact
ggtcacataagagacgtcggcgcagaaaatgggaagtactacgctctaaatgttccatta
aacgatggtatggacgatgagagtttccgcagcttgtttagacctcttatccagaaggtt
atggaggtgtatcagccagaagcagttgttcttcagtgtggggctgactccttaagcggt
gatcggttgggttgcttcaacttatcagtcaagggtcatgctgattgcctccgattctta
agatcttacaacattcctctcatggtcttgggtggtggagggtatactatacgaaatgtt
gcccgttgctggtgttatgagactgcagtagcggttggagtagagccggacaacaatctc
ccattcaatgagtattttgagtatttcggcccagattatacgcttcatgtcgacccaggt
ccaatggagaatttaaacactccaaaagatatggagaaaataaggaacacattgctagaa
caactttcgggactaatgcatgcacctagcgtgcagtttcagcatacaccaccagtaaat
cgagttttggacgagccggaagaagacatggagacgagaccaaagcctcgcatctggagt
ggaactgcagcttatgaatcagacagtgacgatgatgataaacctcttcatggtttatca
ggtcttgatggcccagctatggacagggactctacaggtgaagatgaaatggaagacgat
gataacccagagccggatgtgactcctccatcgtcttaa

DBGET integrated database retrieval system