KEGG   Camelina sativa (false flax): 104733001Help
Entry
104733001         CDS       T05044                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain F1, chloroplastic
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
csat  Camelina sativa (false flax)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:csat00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    104733001
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104733001
Enzymes [BR:csat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     104733001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
12
AA seq 181 aa AA seqDB search
MASSMLSSAAVVTTPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWP
PIGKKKFETLSYLPDLTDVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGR
YWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKPPSFTG
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctatgctctcctccgctgctgtagttaccaccccagctcaagccaccatg
gtcgctccattcaccggcttgaagtcatccgctgctttccccgtcacccgcaaggcgaac
aacgacattacttccatcgcaagcaatggcggaagagttagctgcatgaaggtgtggcca
ccaattggaaagaagaagtttgagactttatcttacctacctgaccttaccgatgtcgaa
ttgggtaaggaagttgactaccttctccgcaacaagtggattccttgtgttgaattcgag
ttggagcacggatttgtgtaccgtgagcacggaagcacacccggatactacgatggacgg
tactggacaatgtggaagcttccattgttcggatgcactgactccgctcaagtgttgaag
gaagtgcaagagtgcaagaaggagtaccctaacgccttcattaggatcatcggattcgac
aacaaccgtcaagtccaatgcatcagtttcatcgcctacaagcccccaagcttcaccggt
gcttaa

DBGET integrated database retrieval system