KEGG   Camelina sativa (false flax): 104736629Help
Entry
104736629         CDS       T05044                                 

Definition
(RefSeq) histone deacetylase 2
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
csat  Camelina sativa (false flax)
Brite
Enzymes [BR:csat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     104736629
Chromosome [BR:csat03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     104736629
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
13
AA seq 387 aa AA seqDB search
MTDTRVISTWTEFTRNSAVYLLFTFLAIKVYKFLFCCNRTSEMSSFSMATHPEALRRERI
LNSKLYFDVPLSKVSIIYSSAYNISFLGIEKLHPFDSTKWGRVCKFLVSDGFLEEKSIVD
PLEASVTDLLVVHSENYLNSLKSSATVARIAEVPPVAFFPNFLVQQKVLYPFRKQVGGTI
LAAKLATERGWAINIGGGFHHCTAERGGGFCAFADISLCVHFAFLRLRISRVMIIDLDAH
QGNGHETDLGDDNRVYILDMYNPEIYPFDYRARRFIDQKVEVVSGTTTDDYLRKLDEALE
VASRNFQPELVIYNAGTDILDGDPLGRLKISPDGITSRDEKVFRFAREKNIPLVMLTSGG
YMQSSARVIADSIENLSRQGLIQTRPE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacagatacccgagtcatctcgacctggaccgagttcactcgcaactcagccgtttac
ttgctcttcacgtttctcgccatcaaagtctacaaatttctcttctgctgtaatcgaacc
tccgaaatgtcatcgttttcgatggcgacccatccggaagctctccggcgggagcgaatt
ctcaacagcaaactctacttcgacgtccctctttcaaaggtttcgatcatctattcatcg
gcatataacatctccttcttgggtattgagaaattgcacccatttgattcgaccaagtgg
ggtagagtttgcaagttccttgtttcagatgggtttttggaggagaaatcaatcgttgac
cctcttgaagcttcagtgactgatcttttagtggttcattcggagaactacctaaacagt
ttgaaaagcagtgctactgtagctaggatagccgaggttccacccgttgccttttttcct
aattttcttgtgcagcagaaagttctttacccattccgtaagcaggttggtgggacgatt
ctggcagccaaactcgcaacagaacgtggatgggcaattaatattggaggaggttttcat
cattgtactgccgagagaggaggcggcttttgtgccttcgctgatatttctctctgtgtt
cactttgcatttcttcgtttaagaatatcaagggttatgataatagatcttgacgctcat
caagggaatggccacgaaacagatcttggcgatgacaatcgcgtttacattctggatatg
tacaatcccgagatataccctttcgattatagagctaggagatttatcgatcagaaggtt
gaggtcgtgagcgggaccaccactgacgactatttgaggaagctagatgaagctcttgag
gttgcttcgcgaaatttccaaccagagttagtgatttacaatgctgggactgatatctta
gacggagaccctctggggcgtctaaagataagccctgatggtataacaagtagagacgag
aaagtcttcagatttgcaagggaaaaaaatattcctcttgtgatgctgacttcaggtggg
tacatgcagtctagcgccagagttattgcggattccattgagaatctctcacgtcaagga
ttgatccagacacggccggaatga

DBGET integrated database retrieval system