KEGG   Cynoglossus semilaevis (tongue sole): 103377304Help
Entry
103377304         CDS       T04866                                 

Gene name
gad2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00250  Alanine, aspartate and glutamate metabolism
csem00410  beta-Alanine metabolism
csem00430  Taurine and hypotaurine metabolism
csem00650  Butanoate metabolism
csem01100  Metabolic pathways
Module
csem_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:csem00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    103377304 (gad2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103377304 (gad2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103377304 (gad2)
   00430 Taurine and hypotaurine metabolism
    103377304 (gad2)
Enzymes [BR:csem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103377304 (gad2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 103377304
NCBI-ProteinID: XP_008306287
LinkDB All DBs
Position
3
AA seq 587 aa AA seqDB search
MASHGFWSLGGDNAAANPGSQSPSTPRAWCQAAAQKLSGGLGSKLCALLNVGEVVEKPAE
AAVKQPPEAAVAGDCGCNKTCNCTKAASVVFSDGFSTDLLPALDGDAKTMTFLQEVVDIL
LSYIVESFDRNTKVIDFHYPNELLQMNNWALQDEPDSLDDILISCRATLKYAIKTAHPRY
FNQLSTGLDMVGLAADWLTSTANTNMFTYEVAPVFVLLEYVTLKKMREIIGWPDGRGDGI
FSPGGAISNMYAMLLARFNMFPEVKEKGMSSVPRLAAFTSEHSHFSIKKGAAALGIGTES
VICIKADESGKLIPADLERRILEAKQKGFVPFFVSATAGTTVYGAFDPLIAISDICRKDN
IWMHVDGAWGGSLLMSRRHRWKLDGVERANSVTWNPHKMMSVPLQCSALLVREEGLMQNC
NQMHACYLFQQDKHYDLSYDTGDKALQCGRHVDIFKLWLMWRAKGTIGFEAQIDKCLELS
EYLYNKIKDREGYEMVFDGKPQHTNVCFWYLPPGVRYIEDKEEKKKQLHKVAPVIKARMM
EYGTTMVSYQPQGDKVNFFRMVISNPAATFEDIDFLIEEIERLGQDL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcatcacacgggttctggtccctcggcggtgataatgccgcggccaaccccgggagc
cagagccccagtacgcccagggcttggtgtcaagcggcggcccagaaattatcaggtgga
cttggatcgaaattatgtgcgctgctgaatgtcggggaggtggtggagaaaccggccgag
gcggccgtcaagcagccgccggaggcagcagtggcaggcgactgtggctgcaacaaaacc
tgcaactgcaccaaagctgcctccgtggtcttctccgacggtttctcaacagacctgtta
cctgccctggacggagacgccaagaccatgaccttcctgcaggaggtggtggacatttta
ctctcttacatcgtggagtcgttcgaccggaacacgaaggtgatcgacttccattatcct
aacgagctgctgcagatgaacaactgggcgctgcaggacgagccggacagtctggacgac
attctcatcagctgccgcgccacgctcaaatacgccatcaagacagctcaccccaggtac
ttcaatcagctctccacaggattagacatggtgggactggctgctgattggctcacttcc
accgccaacaccaacatgttcacctatgaggtggctcctgtctttgtgctgctggaatac
gtcacactgaagaagatgagggagatcattggctggcctgacggacgaggagacggcatc
ttctcccccggtggtgctatttccaacatgtacgccatgctgctggcccgattcaacatg
ttccctgaagtgaaggagaaaggaatgtcatctgttcccagactggcggccttcacgtct
gaacacagccatttctcaatcaaaaaaggtgcagcagctctgggcatcgggactgagagt
gtgatctgcatcaaagcagatgagagtggtaaactgatccctgccgacctggagaggaga
atactggaggccaaacagaagggttttgtgccgttctttgtgagcgccaccgctggtacc
acagtgtacggcgccttcgacccactcatcgccatctctgacatctgcagaaaggacaac
atctggatgcacgtggacggggcctggggtggaagtctcctcatgtcccggagacaccgg
tggaaactggatggagttgagagagccaattctgtcacatggaacccacacaaaatgatg
tctgtccctctgcagtgttcagccctgctggtcagagaggagggtttgatgcagaactgc
aaccagatgcacgcctgttacctgttccagcaggacaaacactacgatctgtcctacgac
accggagacaaagctctgcagtgtggacggcacgtggacatcttcaagctgtggctcatg
tggagggcaaagggcacaattggatttgaagctcaaatcgacaaatgtctggaactttcc
gaatatctctacaacaagatcaaggacagggaaggatacgagatggtctttgatggaaaa
cctcagcacaccaacgtctgcttctggtacctgcctcctggggtccgctacatagaagat
aaagaggagaaaaagaaacagttacacaaggtggcgcctgtgattaaggccagaatgatg
gagtacggcaccaccatggtcagctaccaaccacagggggacaaggtcaactttttccgc
atggtgatctcgaaccctgctgctacctttgaggacatcgactttctcatcgaggaaatt
gaacgacttggtcaagatctataa

DBGET integrated database retrieval system