KEGG   Cynoglossus semilaevis (tongue sole): 103379016Help
Entry
103379016         CDS       T04866                                 

Gene name
kmt5b
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:csem00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103379016 (kmt5b)
Enzymes [BR:csem01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103379016 (kmt5b)
Chromosome [BR:csem03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103379016 (kmt5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
5
AA seq 865 aa AA seqDB search
MKWLGESKNMVLNGRRHRNKLTSEQTANQSQTRSQHSQRMSLRHNKAHPRNRRCSRRFNG
ASLEGERRYVPSSGMSAKELCENDDLTTSLILDPYLGFQTHKMNTRFRPVKGRQEELKEI
IEHFKKHDNLEKAFRALTTGDWSRNLFLHKTKAQEKLFKQHVFVYLRMFATDSGFEILPC
NRYSSEQNGAKIVATKEWKRNDKIEFLVGCIAELSDVEEKLLLRHGENDFSVMYSTRKNC
AQLWLGPAAFINHDCRPNCKFVSTGRDTACVKVLRDIEPGEEISCYYGDGFFGENNEYCE
CYTCERRGTGAFKSKAGLPVEVPVINSKYGLRETDKRLNRLKKLGEGNRSSDSHSVGSHT
DVDSQEMPKTHQSARNRASSSSPSSSELKYKNRTPSRQTLSRALSTSCSKQGRLHNSRVP
KRLKSQTKPSLNKVQLRCRRRAAVTKVWAKGETCQLGLRDSKVSLCKSVNIKTEKDGQEL
VQQALGQRGCLTRHAIKENLLAVQTSEGSQCSTYRTRRSTRTLLKTRETGASVRLKPSLS
PVPGGVVIKTEPADMEEYLPHSAGSSKSMLDSGFARRGTCTRRKRPSRLRAEQTIKHEGS
YGETFVPVAAGLAANHADCEKMLFGFAERHRDYNVLANGSKSLRRDKGKSGCRSQEKGKK
KRQITRYDAQLILENNTPNSIPKLTLRRRRDSSSSSKTNDPYDPFVSSNLSASTVNSASS
SKISIKFSKDHDKDKGSSYIAKLNNGFTPVGHGNATKLKIQLKREDDARRLSQSRAEQMS
YNRDVAQSLEARNGGHRTQNVLAEASSDEDNETGDDDDDYFDNDFEDDFIPLPPAKRLRL
IVGKDSIDIDISSRRREDQSLRLNA
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggcttggcgaatccaagaacatggtattaaatggcagacgacacagaaacaag
ttgacaagcgagcaaactgcaaaccagagccagactcgctcccagcattcccaacgaatg
tccctgcggcacaacaaagcacacccccgaaacagacgatgttcccgcaggtttaatgga
gccagtctggagggagagaggcgctacgtgccctcctcaggaatgagtgccaaggagttg
tgtgagaatgatgatcttacaaccagcctcatcctggacccctacctgggctttcaaaca
cataaaatgaacaccaggtttcgaccagttaaggggcgacaggaggagctgaaggaaatc
atcgagcacttcaagaaacacgacaacctggagaaagccttcagagctttgactacaggc
gactggtccagaaatctgtttcttcataagacgaaagctcaagaaaaactcttcaagcag
catgtgtttgtgtatctgcgcatgtttgccacagacagtggcttcgagattctcccctgt
aatcgatattcgtctgaacaaaatggagctaaaattgtggcaaccaaggaatggaaaaga
aacgataagatcgagtttttggtaggctgcatcgcagagttgtcagacgtcgaggagaaa
cttctgctgcgtcacggcgagaacgacttcagcgtcatgtactccacccgtaaaaactgt
gcacagctgtggttggggcccgccgccttcatcaatcatgattgtcgtccaaactgtaag
tttgtgtcaacaggtcgtgacactgcctgtgtgaaggtcctgagggacatcgaacctgga
gaagaaatctcctgttattatggagatggattttttggagaaaacaatgaatattgtgaa
tgctacacatgtgaacgacggggcaccggtgctttcaaatccaaggctgggctgccagtg
gaggtgccagtgatcaacagcaaatacgggctccgggaaacagacaagcgtctgaaccga
ctgaagaaacttggggaagggaaccgaagctcagacagtcactctgtaggctcgcacact
gacgtggactctcaggaaatgccaaaaacacatcaatctgccagaaatagagcatcatca
tcatcaccatcttcatctgagctgaagtacaaaaaccggactcccagtagacagactttg
tccagagccctttctacctcatgttcaaaacaaggccgcctacacaacagcagggtacca
aagagactaaaatcccaaaccaagccttcacttaataaagtccagttgaggtgtcgacga
agggctgctgtgaccaaggtgtgggccaaaggggagacttgccagctgggtctcagggac
tcaaaggtgtcactttgtaaaagtgtcaacatcaaaacggagaaggacggacaggagctg
gtgcagcaggccctgggtcagcggggctgcctcactcgtcacgccatcaaggagaatctt
ttagctgtgcaaactagcgaaggtagccaatgttccacatacagaactcgcaggtccacc
aggaccttgttgaaaaccagggaaacaggagctagcgtcaggttaaagcccagcttgagt
ccggtcccaggtggggtggtgattaagacggagcctgctgacatggaggagtacctccct
cacagtgctggctcctctaagtcaatgttggactctggctttgctagaaggggcacctgc
accaggcgtaagcggccgtcgcggctaagggccgaacaaactattaaacacgaaggctcg
tacggcgagaccttcgtgcccgtggctgccggcctcgcggctaaccacgctgactgtgag
aagatgctgtttggctttgcagagagacaccgggactacaatgtgctggccaatggcagc
aagtccctgaggcgggacaagggtaagagtggctgtcggtcacaggagaaggggaagaag
aagcgacagatcacacgctatgacgcccagttgatcctggaaaacaacacgccaaacagc
atccccaaactcacgctgcgccggcggagggacagcagcagcagcagtaagaccaacgac
ccctacgaccctttcgtctcctccaacctttctgcttccaccgttaactccgcctcttcc
agcaaaatcagcattaagttcagcaaggaccacgacaaagacaaaggcagctcgtacata
gccaagctgaacaacggcttcactccagtgggccacggcaacgcaaccaagctgaagatc
cagctgaagagagaggacgatgcccgaaggttgtcccagagcagggcggagcagatgtcc
tacaacagggacgtggcccagagtctggaggccaggaacgggggacatcggacccagaat
gtcctggcggaggcttcgtcggacgaggacaatgagaccggggacgacgatgacgactat
tttgacaatgactttgaagatgatttcattccacttcctcccgcaaagcggctccgactc
atcgtgggcaaagactccatagacattgatatctcctccaggaggagagaggatcagtct
ctgaggctcaatgcataa

DBGET integrated database retrieval system