KEGG   Cynoglossus semilaevis (tongue sole): 103384746Help
Entry
103384746         CDS       T04866                                 

Definition
(RefSeq) histone deacetylase 7-like isoform X1
  KO
K11408  
histone deacetylase 7 [EC:3.5.1.98]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
Enzymes [BR:csem01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103384746
Chromosome [BR:csem03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103384746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
10
AA seq 1005 aa AA seqDB search
MFTSQTDGNSSSGNIVKTDRQDTIFHPVADSSVAVHTSCASFPMDLRVGERGMRPGSDTA
LFAPLHPPLLLTQFSSQPCAPFSQQHLHQQIRYNVEQRRREQEHHEKQQELQQLKHKDKS
QQSAVASSLVKQKLQEVILKKRKQAAQQGTNVSALTPAPVVYRNFGPEQGLSSQPLVTSP
SQSSPDGPEGTPLRRATSEPNLKVKHRLKKHLKTRKSPLTRKESAPPTVRHRVPDTLDSS
PSSSSTPVSGCSSPNDSLPNENGLLPSAGGLSHEAQKLLLRDGTLANFTIPSPSTLPTIT
LGLPANARAEEELSSLKVSRVPVVTAGGSPVFLPLSREEQAGHPHLPVIILEPSGLVHTP
LLTVPGLDPVPLQFASQLEHLSPGGSHPHKPLSRTRSEPLPQSTRTLHTQLLQQQHNTQL
LERLKQQTHLGKLMSKSSEKPRLHQIPSEDMDSEDSGAVSPTEPTYQSRARAESLREAEP
GATNSHEEQLNLQHALILNQSLLWEQQKQLQQLHRQMETLAVPMLRVGGGVVGGLGIHRP
LSRTQSSPASTSLTLPEKTLSLSPQDSSSKSRFTTGLVYDSQMLKHQCTCGDNSSHPEHA
GRIQSIWSRLQERGLRGQCESIRGRKATLEELQSVHTERHVLLYGTNPLNRLKLDNRKLA
GILSQRMFVMLPCGGVGVDNDTIWNESHTSTASRMAAGSVVELAHRVAKGELKNGFAVVR
PPGHHADPSNPMGFCYFNSVAIAAKQLQLKLSVSKILIVDWDVHHGNGTQEVFYSDQSVL
YISLHRYDDGNFFPGSGSPAEVGSGAGEGFNVNVAWTGGLDPPMGDAEYLAAFRSVVMPI
AQEFSPDVVLVSAGFDAAEGNPAPLGGYKVSAKCFSFLTRQLMSLAGGRVVLALEGGHDL
TGICDASEACVSALLGIQEPLSEEVLLQKPNANAVRSLQAVIKIQSQYWQSVKAQSGSVS
LSYLAAQRRDCEETDAVNALASLSVGVLSGKSLSDEPMEHDSDSM
NT seq 3018 nt NT seq  +upstreamnt  +downstreamnt
atgtttacatcgcagactgatggaaacagctcgtctgggaacatcgtaaagacagaccgt
caggacaccatatttcatccagtggcagattcctcagttgctgtgcacacatcgtgtgcg
tcctttcccatggacctgagggtgggagagcgggggatgcgcccaggttcagacacggcg
ctcttcgccccgctgcacccacctttactcctcacccagttctcctctcagccctgcgct
ccgttctcccagcagcacctgcaccaacaaatcaggtataacgtggagcagaggaggcga
gagcaggaacatcatgagaagcagcaagagttgcagcagctcaagcacaaagacaagagc
caacaaagtgcagtggccagttccttggtgaaacagaaattgcaggaggtgattcttaaa
aagcggaaacaggcggcgcaacaaggaacaaacgtcagcgcactgactccggctcctgta
gtatacagaaactttggtccagaacagggtctgtcctcacaacctctggttacatctcca
tcacagtcttctcctgatggtcctgaagggacgcctctacgtagagctacgtctgagcct
aatctgaaggtgaaacataggctgaagaaacacctcaagacacgcaagagtccgctcacc
cgaaaagagagtgctccgcccactgtcagacacagagtgcctgacacactagactcatct
cctagcagcagcagcactccagtgtctggctgtagttcaccaaatgacagtttacccaat
gaaaatggactgctgccctctgcaggcggcctctcacatgaggcccagaagctgctgctc
agagatggcactctggctaacttcaccatccccagcccttctactctgcccaccatcaca
ctgggactgccagccaacgcccgggctgaagaggagttgtcttccctgaaggtcagtcgt
gtgcctgtggtcacagcagggggctccccagtcttcctccccctgagcagagaggaacag
gccggacaccctcacctccctgtcatcatcctggagccttctggcctggtgcacactcca
ctgctcactgtgcctggattagaccccgtcccactgcagtttgcctcccagttagagcac
ctgtctcccggaggctctcatcctcacaagcccctgagcaggacacgatcagaaccactt
ccccagagcacgaggacgcttcacacgcagctacttcaacagcaacacaacacgcaacta
ctggagaggctcaaacagcagactcacctgggcaagctcatgtccaagtccagtgagaag
cccagactgcaccagatcccctctgaggacatggactctgaggacagcggagctgtgtcg
cccactgagcccacctatcagagcagagccagggcagagtcactaagggaggcggagcca
ggagcaaccaatagccatgaagagcaactgaacctgcagcatgcgctcatactgaaccag
tcattactgtgggagcagcagaagcagctgcagcagctgcacagacagatggagacactg
gcagtgcccatgctgcgcgtcggtggaggagtggtgggcgggttaggtattcatcgcccc
ctgtcaaggacacagtcatccccggcctcgacgtcactcactctgcctgaaaagaccctc
agcctgtcgcctcaggacagcagcagcaaatcacgcttcaccacaggtctggtatacgac
tctcaaatgctgaagcaccagtgcacatgtggagacaacagcagtcacccagagcatgct
gggagaatccagagcatctggtcacgactgcaggagagaggcctgcggggacagtgtgag
agtattcgtggccgtaaagccacattggaggagctgcagtcggtccacacagagcggcac
gtgttgctctacggcactaacccactcaacagactcaagctggataatcgcaaactggcc
ggaattctgtctcagaggatgtttgtgatgttgccatgtggaggtgtaggggttgacaat
gacacaatctggaacgagtcccacacctcgacagcctcacggatggcagcaggcagcgtt
gttgaactggcccacagagtggccaaaggagagctgaagaacggttttgctgtggtcaga
ccgccaggacatcacgcagatccctccaatccaatgggtttctgttacttcaattcagta
gcaatagctgccaagcagcttcagctcaagctcagcgtcagcaagatcctcatagttgac
tgggatgttcaccatggtaacggcacccaggaagtcttctacagtgaccaaagtgttctc
tacatctcacttcatcgctatgacgatgggaacttcttccctggcagtgggtcacctgct
gaggtcggttctggagcaggggagggcttcaatgtcaacgtcgcatggaccggaggactg
gacccacccatgggagatgcggagtaccttgctgcattcaggtctgtggtgatgcccatc
gctcaggagttcagccctgacgtcgtcctggtgtcggccggatttgacgcggcagaagga
aacccagctcctctgggaggatacaaggtctcggccaagtgtttcagcttcctgacccgt
cagctgatgtctctcgcaggcggtcgtgtcgttctggccctggagggaggtcatgacctg
acagggatctgtgatgcgtctgaggcctgtgtcagtgctcttctgggtatacaggagccg
ctgtctgaagaagtgctgcttcagaaacccaacgccaacgctgtccgctcgctgcaggcc
gtcattaaaatacaaagtcagtactggcagagtgtgaaggctcagagtggatcagtgtct
ctgtcctacctggctgctcagagaagagactgtgaggaaacagatgccgtcaatgctctg
gcctcactgtctgtgggtgtcctctccggcaagagtctctctgatgagccgatggagcac
gacagtgactccatgtag

DBGET integrated database retrieval system