KEGG   Cynoglossus semilaevis (tongue sole): 103386425Help
Entry
103386425         CDS       T04866                                 

Gene name
pcsk1
Definition
(RefSeq) neuroendocrine convertase 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
Enzymes [BR:csem01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     103386425 (pcsk1)
Peptidases [BR:csem01002]
 Serine Peptidases
  Family S8: subtilisin family
   103386425 (pcsk1)
Chaperones and folding catalysts [BR:csem03110]
 Intramolecular chaperones
  Subtilisin family
   103386425 (pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert
Motif
Other DBs
NCBI-GeneID: 103386425
NCBI-ProteinID: XP_008318899
LinkDB All DBs
Position
11
AA seq 784 aa AA seqDB search
MEVRCPRPAVMCCVFALLLFPGSSLQQQQQRGWGSSYRDRQYLNEWAVEIPGGPSVAEGI
AKELDYQLVRQIGALQDHFLFKHRTHPSRMKRSATHITRRLSEDDRVLWAEQQYEKRRSK
RASLRECRECPVDKLFDDPMWNQQWYLQDTRTSSSLPKLDLHVIPVWQKGITGKGVVITV
LDDGLEWNHTDIYSNYDAAASYDFNDNDPDPFPQYDSTNENKHGTRCAGEIAMQADNNKC
GVGVAYNSKVGGIRMLDGIVTDAIEASSIGFNPDHVDIYSASWGPNDDGKTVEGPGRLAQ
KAFEYGIQKGRRGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAE
KCSSTLATAYSSGDYTDQRITSADLHNECTQTHTGTSASAPLAAGIFALALEQNPDLNWR
DLQHIVVWTSEFDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPGSWKHVPEKK
QCIVRDDSFQPRELKAAGEITIEIPTKACAGQENVILSLEHVQVEASIEYTRRGDLHITL
TSPAGTNTVLLAERERDTSANGFRNWAFMSVHTWGENPAGTWTLKITDTSGRMENKGRIL
NWKLILHGTSEKPQHMKKPRVYIPYNAVQNDRRGVEHMDDMMEEPTQAHPPPPTDAVRSP
ASSKLEKASEKPSNSALSPSVALLRLLQTAFNRHTPLQDPRAPTRTSSSVRSKQQQSNRI
SSPVSTRLPPQQLYQALDLINRYRGPGDSVYNDYSDDFYSNKHYRHRDDLLLQALVDMIG
DDGM
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgagatgtcctcgtccagcggtgatgtgttgcgtcttcgccctcctgctgttt
cctggttcttctctgcagcagcagcagcagcggggatggggatcctcttacagggacaga
cagtatctgaacgagtgggcagtggagattcccggcggcccctccgtggccgagggcatc
gccaaagagttggactaccaactggtccgacagattggggccctacaagaccatttcttg
ttcaaacaccgaactcatcctagcagaatgaaacgaagtgccacccacatcaccagacgg
ctgtcagaggatgatagggtgctgtgggcggagcagcagtatgaaaagcgacgcagcaag
cgagcgtctctgagggagtgcagagaatgtcctgtggataagctctttgatgatcccatg
tggaaccagcagtggtacctgcaagacacacgaacgtcctcctctctgcctaagctggac
ctgcatgtgatccctgtgtggcaaaaaggcatcacaggaaaaggagtagtcatcactgtt
ctggacgatggcctagagtggaaccacactgacatctattccaactacgatgcagcagcc
agctacgacttcaacgacaacgacccggacccttttccccagtacgactccaccaatgag
aacaagcatggaaccaggtgtgctggagaaattgccatgcaagcagacaacaacaagtgt
ggtgtcggagtggcatataactccaaggttggagggattcgaatgctggatgggattgtg
acggatgctatagaggccagttctattggtttcaaccctgaccatgtggacatctacagt
gccagctggggacccaacgatgacggaaagacagtggagggccccgggcgcctggcccag
aaggcttttgaatatggtattcagaagggccgtcgaggaaaaggctctatctttgtttgg
gcgtcaggtaacggcggcagacagggcgataactgtgactgtgacggctacacggatagc
atctacaccatctcgatcagcagcgcttctcagcagggcctttcaccgtggtacgctgag
aagtgctcgtccactttggccacagcctacagcagtggagactacactgaccagaggata
acgagtgctgacttgcataacgaatgcactcaaactcacaccggaacatcagcctctgcc
ccactggctgctgggatttttgccttagcactggaacaaaatccagatctgaactggaga
gacctgcagcacattgtcgtctggacctctgagtttgatcctttggccaataatccaggc
tggaagaggaatggagcggggctgatggtgaacagtcgttttggttttggtctcctgaat
gccaaagctctggttgatctggctgacccaggcagctggaagcatgttcctgagaagaag
cagtgtatcgtcagagatgattctttccagccacgggagctgaaagcagcaggtgagatc
accatagagattccaactaaagcctgcgcaggtcaggagaatgtgatcctgtcgctggag
cacgtgcaggtggaggcgagcatcgaatacaccaggagaggagatctgcacatcaccctc
acctccccagcaggcacaaacaccgtgcttctggctgagcgtgagagagacacgtctgct
aacggtttcagaaactgggccttcatgtcggttcatacctggggggaaaatcctgctggg
acatggaccctgaagatcacagacacttctggtcgaatggagaacaaaggccggattctg
aactggaagttgattcttcatggaacatcagaaaaaccacagcacatgaagaagcctcga
gtgtacatcccatacaacgccgtgcagaacgacagacgtggtgtggagcacatggatgac
atgatggaggagcccacacaggcccatccacctcctccaacagatgctgtacgatctcca
gcctcctccaaattagagaaagcttctgaaaagccctcaaattccgccctctctccctca
gtggccctgctgcgattactgcagacggcctttaacaggcacactcctctgcaggatccc
cgagccccaaccagaacctcctcctcggtcaggagtaagcagcagcaatcgaacaggatc
tcctcccccgtttccaccagactccccccgcagcagctgtaccaggcactggatcttatc
aacaggtaccgaggcccaggggacagtgtctacaacgactacagcgacgatttctacagc
aacaaacactacaggcacagagacgacctgctgctgcaggctctggttgacatgataggt
gatgatggaatgtaa

DBGET integrated database retrieval system