KEGG   Cynoglossus semilaevis (tongue sole): 103386797Help
Entry
103386797         CDS       T04866                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E-like
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
Enzymes [BR:csem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103386797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
11
AA seq 748 aa AA seqDB search
MTTPVSVFKNVEHNCERNNVNHHTSDVTVKELLVRRGQPFTLNLELSKPFTPDRHPLTIS
GLTGSNPSKDLGTSFVLRIPPNQSLLSKVMWKVKLKKKSSSAKGDLRLKITPPANAPIGE
YILTVSHRGEETLLAMPVVLFNPWCPDDTVFLPDEEKRQEYVMNEQGIIYKGSGNYITPM
DWNFGQFEPDMVKICMKILDMNNNHGEDPAKDVSSRCDPIYVGRVVSAMINSEDDHGVLM
GRWGGSYAGGFRPSHWNGSHAILKSWFNIDCHPVKYGQCWVFAGVMCSVMRLLGIPCRVV
TNFNSAHDTNKNLVIDMYHADYGVAPKDSRDSVWNFHVWVEGWMKRPDLAEDGKYDGWQV
LDPTPQEMSDGLYCCGPAPVKAILMGDVDLEYDVPFVFAEVNADCIDWLIKADGTKMKIY
SDTERVGQNISTKSVGSNKRRNITDCYKHREGSDRERDVYKYALTRDFTREEEDDLVGVE
EGEEAEESMEAGGAEERNSNLNVNAESTGGGGTDVVTPGVPPPPPPPPPPPPPPVYMRFE
EVSKPINGKDVDLKLVLNSKSTEPRRLSIVVSAQVMNYNGSSAVNIMMEEKEETVPVGKD
LSLPILIPFSTYHKYMMDGDNIKISAVVTDMENPVNIYLAEDNVVLQEPPLAIVAVSTEL
SVNKKAEAVVIFKNPVKEELQECMLSLSGSGLLKDEVVHKLPNLPPDKLLRCTVQFVPYK
TGQLKLLVDFDCSTFRDIKGSIDFTVIP
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgacgactccagtatcagtttttaagaacgtggaacacaactgtgagcgcaacaacgtg
aaccaccacaccagtgatgtcacggtcaaggagctgctcgtgaggcggggccaacccttc
actctgaacctcgagctgtccaagcccttcacccctgaccgccatccgctgacgatcagt
ggactgacaggctcaaatccctccaaggacctggggacatccttcgtcttacgtattcca
ccaaaccaatcattattatcgaaggtaatgtggaaggtcaaactgaagaagaaatcctcc
tcagcgaagggagacctgcgcctgaagattaccccgccagcaaatgccccaataggggag
tacatactgacggtgtcacaccggggcgaggagaccttgctggcgatgccggtggtgctg
ttcaacccctggtgtcccgacgacaccgtgtttctccctgacgaggagaaacggcaggag
tacgtgatgaacgagcagggaatcatctacaaaggaagtggaaactacatcacgcccatg
gactggaactttggacagtttgagcctgacatggtgaagatctgcatgaagattctggat
atgaacaacaaccacggcgaagaccccgctaaagatgtttcctcgcgctgtgatcccatc
tacgtgggccgcgtggtcagcgccatgattaacagtgaggacgaccacggtgttctgatg
ggaaggtggggaggttcgtatgccggtggattccgtccctctcactggaacggaagccac
gccatcttgaagagctggtttaacattgactgccatccggtcaaatacggccagtgctgg
gtgttcgctggcgtgatgtgttcagttatgcgtctgctgggcatcccctgtcgtgtggtc
accaacttcaactcggcccacgacaccaataagaacctggtcatcgacatgtaccatgct
gactatggtgttgctcccaaagattcacgggacagtgtttggaattttcatgtgtgggtg
gaggggtggatgaaacgtcccgacctggcagaagatgggaaatatgacggctggcaagtt
ttggatccaacaccccaagagatgagtgatggtctttactgctgtggtccggccccagtt
aaagccatattgatgggggacgttgaccttgaatatgacgtcccatttgtcttcgctgag
gtcaacgcagactgtatcgactggctgatcaaagccgatggcacgaaaatgaagatctac
tccgataccgagagggtgggtcagaacatctccaccaagtctgtgggctccaacaagagg
aggaacatcaccgactgctacaagcacagagaggggtcggacagagagagagacgtctac
aaatatgctctgaccagagacttcaccagagaagaggaggacgatttggtgggggtagag
gaaggggaagaggcggaggagagcatggaagcgggaggggcggaggagaggaactcaaat
ttgaacgtcaacgctgagagcaccgggggtggaggaacagatgtggtcactcctggcgtc
cctcctccacctccccctccacctccacctccacctccacccgtctacatgcgttttgag
gaggtgtctaagccaataaacggaaaggatgtagacctgaagctggtgcttaacagcaag
agcaccgaacccaggcggctctccatcgttgtcagtgcccaggtgatgaactacaacggc
tcatcggcggtgaacatcatgatggaggagaaggaggagacggtgccggttggcaaagat
ctttccttacctatcctgatcccattctcaacctaccacaagtacatgatggacggcgac
aacatcaagatctcagctgtggtgacggacatggagaatccggtgaacatctacctggct
gaggacaacgtcgttctccaggaaccgcctctcgccatcgtcgcggtttccactgagctc
agtgtgaacaagaaggcagaggctgtggtgattttcaagaacccggtgaaggaggagctg
caagagtgcatgctgtccctgtcagggagtgggttgctgaaggacgaggtggtccacaaa
cttcccaatctgccgccggacaaactattacgttgcactgttcaattcgttccctacaaa
actgggcaattgaaactgttggttgactttgactgctccaccttcagagacatcaagggc
agcatcgacttcaccgtcattccataa

DBGET integrated database retrieval system