KEGG   Cynoglossus semilaevis (tongue sole): 103388508Help
Entry
103388508         CDS       T04866                                 

Gene name
kmt2b
Definition
(RefSeq) histone-lysine N-methyltransferase 2B isoform X2
  KO
K14959  histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:csem00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103388508 (kmt2b)
Enzymes [BR:csem01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103388508 (kmt2b)
Transcription factors [BR:csem03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    103388508 (kmt2b)
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103388508 (kmt2b)
   HMT complexes
    MLL3/MLL4 complex
     103388508 (kmt2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET FYRC PHD FYRN zf-CXXC zf-HC5HC2H PHD_2
Motif
Other DBs
NCBI-GeneID: 103388508
NCBI-ProteinID: XP_008321761
LinkDB All DBs
Position
13
AA seq 3833 aa AA seqDB search
MMAAAGCGSATAAAVGGQGGTATARGRFPGRPWSSRSRLRSEKRWQLGRSGLEADDVTSG
GPRPANLVLSLNEDQSHLRLLGIEASHKVLGQAGYSSSGSEEGDDFRGFEAERRGPRGTG
RQNPSKGDAGNTKSKQQQREKLPSNMPSVEAVTSPPDPVEDVKASEEDGLSSEAQPAKDG
KKGSTKRKTMDRRSSKSRASSAAPRITIKLVAKKKTVKERHETSTKKKKSQDIQANQISS
AHVKLKAELPEGDLGTEDSVDGTLPVRRRGRSASKVTETVCQPSPKALVNDQKLKDGKPT
DPCVTAIEGQTKEPKINAKKLKHRDVLIEQISEVNQRAVRRSSRVSNPLSNSVTDCLHAA
ESQSKNATVPVESKTVPTTVEFKQVQRRTRQRQSKRLNKEVAVSENYTPSSTDTSSVKDE
MRIPSLKLIRVRNPKYDAQASGKDSARKKKRKKFIWTLTLVKEEVQKLSVENTEKVAEET
VTEVDQSTLSNAGIAEIVGEVDKILQTPSPPESKPQNKGDVLVEEKSIPLLEVSEDPATE
VSPVEIQKADCGKVPPLQIKKVSSPSKRKKSSKPSFLIQQVVPVHEKEDVLKDPSETHED
NSTGLDTVVAPTRRLRRRAPTLDSRQTKSLSHKPVPTQKRRLRKSPQERAAQQVLVNDPH
QVSSDDLIPQVLPENSGPVLPAEPSPVTNTVATDVLERNSLRTDDPSHLPGEISPCKVEM
EKKEETQHKEAKDLSLVENKVEMQKEEAKTLTVLEKDVETQNQEATSSPVVEKVAGAEIE
EATPSPVVEEKLDTQNQEDNPLPAMEHRVEPQHEDAKTLPALEEEAKTLAVASKPKRSRN
SKVGKKKSTQKKKAVVPSDTTVHTEEAAAEPVNTESALKTDTLPVQAVVGLSEEVESEAQ
QKLALEPDEQIQPLVKEETNIQLIDGGQLFVCESEASQPQTLCLQRKPLKKAKKRRKSLI
GQRQKHRYRNREGKFAPLELSDAEKVVEGESDISKSLEDTTLSLSSKLVGVQKRYKKTES
GLQILGSKSPEPQAKIISTLLEMGLEKDNLKQEETDTLVDGGQTDIVETQPSKSKFMKNI
KHFIMPVVSARSSRVIKTPQRFMDDAGMSVLPRRNSPKKGVQLGVPVRSAKRRDDVMSRP
ISPFLPVEDEDLLSEAHLDVDLFSAQDLEDNLDIAESLFSEKKRTKGEKSRSLFKNSSFK
WHMPEESNEDEYTLDKALEEKCEGLFLSSPTDKPTEVTAGLVGAQKTKSSPKFAKQSAPM
KIFQKLNKVHTVFSKSKSSAEVLDSATKPPQFSVDLAEGLDDEAISISLRQRNTSSEKEK
SKLKIEDLGTPGVVRKVCIKAANFKSFLFQQTSDENQARRHSVKPLSGEQRSEKNADTVS
GDCPGSVEKGPSQRARLTGANKRMFNLLRKAKVQLIKIDQQKQLKSSRLLSGPSGARARD
MTSKREKRKKRMQPLPVVPVKTEPPQVQPQVISPLCQEFRRAGGPRIKHVCRAASVVLGQ
PRALVPDDIPRLSALPLHERSGISPSAVTKDVGSPSESDSPELSDAKVTKVKKPSSFAKR
KGLGPFGYRSRRCGVCKGCNHEEDCGKCINCLDKPKFGGPNTKRQCCVYKRCDQIEERKA
RRLSGRAAPKGSSKRRRSPFIGGYSSNEEGNECAADSPSGLQGEGSSPSVRKQPKRVVKP
RVYFDLVDYDSEDDDKAASSSASPARRRGAGHRFSQDFVSLDGFLGDISDEEIRHRKSSS
HRVQPVRRKPEKGQTSQGPLEQTPPSVLAALAHGFEQREVESSKPTHKIRVDFKEDCALE
NVWNMGGLSVLSSAPVMPPYVCFLCASKGQHEMLYCQVCCEPFHQFCLEASERPSEENKE
NWCCRRCKFCHVCGRRNKLSKPLLECEQCQNCYHASCLGLNYPKQNKKRKAWVCMTCIRC
KSCGVTPGKSWDTDWNHDKGLCPDCSKLYDQGNYCPICFKCYEDNDYDSQMMQCGTCNHW
VHAKCEDLTDELYEILSSLPESVVYSCRPCSVTQPSAWRELLYIELRSGVEKVLACLLSS
TLTQHLVTCSQCEKLTDSDSGREGQPACDLRAVGKKFDKGLYTSLKMFHEDVVQVVRNKL
EQEDELPEEQRPTALARSYYLKLLEEVFNWFNSQDPKVWNPCTKDLPMGMLSHAVQPPTT
EHVYAQWKERGELPSRAPLGLLQEDNREGSDVKEEEALSPMSGELMSRNHFKTSRAVRLK
FKGKRGRLSKADLDTGWSTEDERQCSLCQKYGDLKPNEAGRLLFLGQNEWAHVNCCLWSA
EVFEEDNGSLLHVHSAVTRGRLMRCERCNQTGATVGCCLTSCQSNYHFMCARSRHCVFQD
DKKVYCHKHRHLISGRMVTGQEFEVNRRVYVDFEGISLRRKFLTGLEPEVINVMIGSLQI
EKLGVLTELSANRGKLCPVGFQSSRWYWSTVNPLRRCKYTCTIREVRPIVPEKPVEDLPN
QGHNHTISHSPRPLPVSDVAEAPLTDPQPLSEESLVLGPPLRAESSARPKLPSKSQTRRP
AGGLSRPLPSPGTAGLKPHHILTISDFEETRRSHHHGSHSHTTGPRSHMPPPLGPLTGPV
SLRTGKSSLPASPLFPLPPDNLLSSPSSRPGGGRSASSIRSTGNTSAFFPQSSWQDSAGN
FPPPSLSFSSSIHLPRPRLSFDLSQSDSVEVPHNFLASPEPEDVSPANGTSPLRDLDPQR
DVKDFSYSSFHKDSTLNLGQEMRTELEIEETLLNEGVAMNCEGQIVVEGEDQEEFWEAAK
DQHKKKKKKTLVASLPRSAAAARKDIGNTSSSDEDMEHYFDFSRTIVSHSRSKDLAKCPS
PPSSRTLAQLDGVDDGTESDASIVTNDDAQKVAQNAKNPKNKKFTGFQTANCTNAVHSPV
PEASSSDKHKDSNPYGAREDSKKDLLSVDNKGFVSSQFSADQSSCVNLPTIPPTPVDPSP
ANTAGNSKGVLQDLLKPPSISTEVQAPSHGLMDSMQMFSQSSLTSITLQPVTCSQECATF
SSPSTKLTTLTPVGDLTQPLSNVFLQNDPVLSASSGTLPSVETVPGTIYSSDAQALVSTA
VPIVSSSASLSELSTPTAAPPAVQTTTTPVILNGYSSSSVQKDTASGHTISINFSTPRPA
LEPQLLAPQALSGHAILTVKEVGGPNVDPTPHVLLVNRLGQIFVKNPESNTFQLPTPNSS
SYNCVTQIASLLQSNALSATLAAAGNMSVQTPVANVVQGAAPPVAPVEQNPTTIMQLLTH
NSNGAVASVNVKKPKKNTKASKDETALELKKPKKKKESSAPKKSKSSKAAGSAAVSTPKP
PVTPAESAQAIIYQAMASNYTPKYSGIRSLSPSSLVLPPGLLIEPEELENLKCPRSPSPP
PPPAPPPALPAPSVSAPRPRTHVRMKRVSSLSDRIVTKKSKVDFLKPEPIHEQEEQQQPA
PAPAPPQRHKVTPQSVSSRASGVRIKTPTVKGILNLDEVKEEHMSDSDSTGSNSLEFMSR
VDQGKQVVREPVGHNNLTDWRKYSGAASASDEEPPISDEDEEFPTNKEQPHLRFEITSDD
GFSVEADSIEVAWKAVIDGVQEARAITRLRPLTFQKITGALMFGLLHDTVVFLLEQLEGA
PRCQRHKFRFFKQFSQEDDLPVNPSGCARSEIHLRKSTFDMFNFLASQHRQLPDIGPYDD
EEDEILLKSTRRATSLELPMAMRFRHLERTSKEAVGVYRSAIHGRGLFCKRNIEAGEMVI
EYAGIVIRSVLTDKREKYYDGKGIGCYMFRIDDFDVVDATMHGNAARFINHSCEPNCYSR
VINVEGRKHIVIFALRKIYRGEELTYDYKFPIEDASNKLGCNCGARRCRRFLN
NT seq 11502 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggcagcgggatgcggatcagcaaccgcggctgccgtaggaggccaaggtggc
accgctacggccagaggccgtttccccggtcggccctggtcgtcacgcagtcgtttgcgc
tctgagaagcgatggcaactcggacgttcaggcttagaagccgatgatgtgactagcgga
gggccaaggcccgcaaacctggttctgtcgttaaacgaagaccagtctcacttgcgttta
cttggaatagaggcgagtcacaaggtccttgggcaagctggatacagctctagtgggagt
gaagagggagatgacttcagagggtttgaagctgagagacgaggtcccagagggacgggc
cgacaaaatccttcaaaaggtgatgctggcaacacaaaatctaaacaacagcaacgtgag
aagctaccatctaacatgccatcagtggaggcagttacttccccacctgatcctgtcgaa
gatgttaaggcttcagaggaagatggtttatcttctgaagcacagcctgcaaaggatggc
aagaaaggttcaacaaaaaggaagactatggatcgacggtccagtaaaagcagagcctca
tcagcagcaccaaggattactataaagttggtggccaaaaagaaaactgtaaaggaacga
catgaaacatcgacaaagaaaaagaagtcccaggatattcaggccaaccagatttcaagt
gctcatgtgaaattaaaagcggaattacctgagggtgatcttggcacagaagatagtgtg
gatgggacacttcctgtaaggaggcgtgggagatcagcttcaaaggttacagagactgtc
tgccagccaagcccaaaagctttggtcaatgaccaaaaactgaaagatggcaagccaact
gatccatgtgtcactgccattgaaggtcagacgaaagagccaaaaataaatgcaaaaaag
ttaaagcacagggatgttttaatagagcaaatttcagaagtaaatcagcgcgcagttcgc
aggagcagtagagtgtctaacccactctccaacagtgtaacagactgtctgcatgcagca
gaaagtcagagcaaaaatgctactgttcctgtggagtcgaaaacagttcctacaactgtg
gagtttaaacaagtgcagagaaggaccagacaaaggcaaagcaagcggttaaataaggag
gttgccgtctcagaaaactacactccttcatccacagacacttcttctgtaaaagatgaa
atgaggatcccaagtttaaagctaatacgggtcagaaacccaaaatatgatgcacaagca
agtgggaaggattcagctcggaagaaaaagcgtaaaaaatttatatggactttaacattg
gtgaaagaagaagttcaaaaacttagtgttgaaaacactgagaaggttgcagaagaaact
gtgaccgaagtggatcagtccactttatctaatgcaggtattgctgaaatagtaggcgaa
gtggataaaatactacaaaccccttctccaccagaaagtaaaccccaaaataaaggcgat
gtgttagtcgaagaaaagtccatcccgttattggaagtatcagaggaccctgcaactgaa
gtttctcctgttgaaatacaaaaagcagattgtgggaaggttccacctcttcagattaaa
aaggtctcctccccgagtaagcgtaaaaaaagctccaagccttcattcttaattcaacaa
gttgttcctgtacatgaaaaggaggatgttctcaaagatccaagtgaaactcatgaggat
aattcaacaggtctggatactgtagttgcaccaactaggaggctacggaggagggcacca
actcttgactccagacaaaccaaatctctcagtcataaaccagtgcccactcagaaaaga
agactgagaaaaagtccgcaggaaagagctgcgcagcaggtgcttgttaacgaccctcat
caggtttcaagtgatgatttgattccacaagttcttcctgaaaactctggtccagttttg
cctgcggagccttcaccagtgacaaatactgtcgccactgatgttcttgagagaaactct
ttaagaacagatgacccatcacatctgccgggagaaatctctccatgtaaggtggagatg
gagaaaaaagaagaaacacaacataaagaggccaaagacttgtcattggtggagaacaag
gtggaaatgcagaaggaagaggccaaaacattgacagtgttggagaaagacgtcgaaaca
cagaaccaagaggccacctcttctcctgtggtggagaaagtagcaggtgcagagattgaa
gaggccactccatcgcctgtagtggaggaaaagctggatacacagaatcaggaggacaac
ccattgcctgcgatggagcatagagtggaaccacagcatgaagatgccaaaacattgcct
gcattggaggaagaggccaaaacattggccgtggcttccaaacccaaaaggtctagaaac
agtaaagtaggtaaaaagaaatctactcaaaagaagaaagctgtggtcccctctgacacc
actgtccacactgaggaggctgcagctgaaccagtcaacacagagtctgcactaaagaca
gacactctgcctgtacaagcagtcgtaggtctgtcagaggaggttgagtctgaggcacaa
cagaagcttgcattagagccagatgagcagatacagccactggttaaagaggaaacaaac
atccagctaatagatggtggacaactgtttgtatgtgaaagtgaagcaagtcaaccacaa
actttgtgccttcaaagaaaaccactaaaaaaagcaaaaaagagacgtaagagtttgatt
gggcagcgacagaagcacaggtacagaaatagagaagggaagtttgctccacttgagttg
tctgatgctgagaaagttgttgaaggggagagtgacatttccaaatcattggaagatacc
actctctctttgagctctaagctcgttggggtgcagaaaaggtacaaaaagacggagtca
ggccttcagattttggggtcgaagagtccagaaccacaggctaaaattatttcaacactt
ctagaaatgggccttgaaaaggataatttaaaacaggaagaaacagacacgttggtcgac
gggggccagactgacattgtagaaacccagcctagtaaatcaaagtttatgaaaaacatc
aagcacttcataatgcccgttgttagtgccagatcctccagagtgataaagacaccacaa
agatttatggacgatgctggaatgtcggttctgcctcgaagaaactctccaaagaagggc
gtacagctgggtgtgccagtacgttcagctaagagacgggatgatgtgatgagcaggccg
atttcacccttccttccagttgaggatgaggacttattaagcgaagctcacctggatgtt
gatctgttttcagctcaggacttggaggacaacttggacatagccgagagcctgttctca
gagaaaaaacgcaccaagggtgaaaaaagtcgctctctttttaagaactccagtttcaag
tggcacatgccagaagagtctaacgaggacgagtatacactggacaaagctctggaagag
aaatgtgagggtctgttcttatcctcacccacggataagccaacagaagtaactgctggc
cttgtaggtgcacagaaaacgaaaagttctcctaaatttgctaaacaatcggctcccatg
aagatctttcaaaagctaaacaaagtgcacacagtgttctctaaaagcaaaagttcggcc
gaagttttggattctgcaactaaacctccacagttttctgttgacctagcagaaggtctc
gatgacgaggccataagcatcagcctcagacaacgaaatacatcgtccgagaaggagaaa
tcaaagctcaagatcgaagaccttggcactcctggagtagtgagaaaagtttgtatcaag
gccgcgaacttcaagtcctttctttttcagcagacgtcagatgagaaccaagccaggaga
cacagcgtcaaacctctctcaggtgagcagcggtcggaaaagaacgctgacacagttagt
ggagactgtcctgggtctgtggagaaaggtccctcacaaagagcacgtctgactggagca
aacaagcgaatgttcaatctcctcaggaaagcaaaggtccagctcataaaaattgatcaa
cagaagcagctcaagtcatccaggctgttatctggacccagtggcgccagggctcgtgat
atgacctccaagagagagaagaggaagaagaggatgcagcctctacctgttgttccagtc
aagactgagccaccacaagtacaaccccaggtcatctccccactttgccaggagttccgt
agagctggaggacctagaatcaagcatgtgtgccgtgctgcttctgtggtgctgggacag
cctcgggccttggttcccgatgacattcccagactcagcgcgttacctctccatgagaga
agtggcatttccccatctgctgtcactaaagatgttggatccccatcagaatcagacagc
ccagaattgtctgatgcaaaggtcaccaaggtcaagaaaccctcaagttttgcaaagcgg
aagggactgggaccctttgggtatcgttctcggagatgtggagtgtgcaaaggctgtaat
cacgaggaggattgtggcaagtgcataaactgcctggacaaaccaaagtttggtggacct
aataccaagaggcagtgttgtgtctataagagatgtgatcaaattgaggagaggaaagca
cgacggctgagtggaagagcagctcccaaaggttcatccaagaggcggcggtcgcctttt
atcgggggttattcgagtaatgaagaaggaaacgagtgtgccgcagactcgccctctggt
cttcagggtgaaggcagcagtccctcagttaggaaacaaccaaagcgtgtcgtgaaacct
cgtgtctactttgacctggtggactatgactcggaggacgatgacaaagctgcctccagc
tctgcatcaccagccaggagaagaggtgctggacaccgcttcagtcaggactttgtgtct
ctggatggattcttgggagacatttcagatgaagaaatacgtcatcgaaagtccagttca
caccgtgtacagcctgtgcgccgcaaaccagagaagggtcagacatctcagggaccgttg
gaacagactcctcccagtgtgctggcagcattggcccatggttttgaacagagagaagtt
gaatcttctaaacctactcacaaaatcagggttgacttcaaagaggactgtgcgttggag
aatgtctggaacatgggtggtttgagcgtcctgagctctgcaccagtcatgccaccctac
gtctgcttcctttgtgccagtaaaggccaacatgagatgctgtattgccaagtatgctgt
gagcccttccaccagttttgccttgaagcatcagagcgcccctcagaggaaaacaaagaa
aactggtgctgtcgtcgctgcaagttctgccacgtgtgtggcaggagaaacaaactttca
aagcctttgttggagtgtgaacaatgccagaactgttatcatgcttcctgtctgggactc
aactatccaaagcaaaacaagaaaagaaaagcttgggtgtgtatgacatgtatcaggtgt
aaaagttgtggcgtcacaccagggaagagttgggacaccgactggaaccacgacaaaggc
ctctgtccagactgttccaaactttacgaccagggtaactactgtcccatttgcttcaag
tgctatgaagacaatgactatgacagtcagatgatgcagtgtggaacctgtaaccactgg
gtacatgccaaatgtgaggatctcacagacgagctctacgagatcctgtccagcctgcca
gagagcgtggtgtactcgtgccgaccctgcagtgtgacccagcccagtgcctggagggag
ctgctgtacatcgagctcaggtctggggtggagaaggtgttggcgtgcctgctttcctcc
accctaactcaacaccttgttacttgctcacagtgtgaaaagttaactgattctgacagt
ggaagagaaggacagccagcctgtgatcttcgagctgttggcaagaagtttgacaaaggc
ctttacacctcactgaaaatgttccatgaagatgttgtgcaggtggtacggaacaagctg
gagcaagaagacgaacttccagaggagcagagacccactgccctggcacgctcttactac
cttaagctccttgaagaggtgtttaactggtttaacagtcaagatccgaaggtgtggaac
ccttgtaccaaagatttgcccatggggatgctctctcatgccgtccagcctccaaccacg
gagcacgtgtatgctcagtggaaggagaggggggagcttccatcaagggctccactgggg
ctgctgcaggaggacaacagagagggctcagatgttaaagaagaggaagctctttctcca
atgtctggggagctaatgagcaggaatcacttcaaaaccagcagagcggtcagacttaaa
ttcaaaggtaaaagaggccggctctcaaaggctgacctggatacaggatggtcaacagaa
gatgagagacagtgctcgttgtgtcaaaaatatggagaccttaaacctaatgaagcagga
aggttgctgttcctgggccagaatgagtgggcacacgtcaactgttgtctgtggtccgca
gaggtgtttgaagaggataatggctcgttgttacatgtgcacagtgctgtcacaagaggg
cgcttaatgagatgtgaacgttgcaaccagacaggtgccacagtgggctgctgcctgaca
tcctgtcaaagcaactaccacttcatgtgtgcccgctcccgtcactgtgtgttccaggat
gacaaaaaggtttactgccacaaacaccggcatctcatcagcggcaggatggtgactggt
caagaatttgaggttaatcgcagggtgtatgtggactttgaagggatcagcctccgcagg
aagttcctgacagggttagaaccagaagtgatcaatgtcatgattggttccttacagata
gagaagctgggtgttctgacagaactttctgctaacagagggaaactgtgtcctgtgggg
tttcagtcttcccggtggtactggagtacagtcaatcctctgcgtcgctgcaagtataca
tgtacaatccgggaggtccgacccattgtccccgagaagcctgttgaggacctgccaaat
caaggccacaatcacacaatatcccacagtccacgtccacttcccgtgtctgacgtcgca
gaagctcctctgacagaccctcagccactatcagaggaaagcctcgtcctcggaccaccc
ctcagggcagagagcagtgcacgacctaaacttcccagcaaatcccaaaccaggagacca
gctgggggactgtcccgacctctgccatctccaggaacagctgggttaaaaccccaccac
atattaaccattagtgactttgaggagactcgaagatctcatcatcacggctcacattca
cacacaacaggccctcgcagtcacatgccccctcctttgggacctctgactggacccgtc
tcccttcgtaccggaaagtcctccctgcccgcctccccactgtttcccctgcctccagac
aacctgttaagttccccttcatcacgtcctggtggaggcaggagtgcttcctccatccga
tccactgggaatacctcagcatttttccctcagtcgtcctggcaggacagtgcaggaaac
tttcctccgccaagtctgtctttttcttcctccatccatttgcccagacctcggctatcg
tttgatctcagtcagtctgactcagtggaggtgccgcacaactttttggcttcaccagag
cctgaagatgtgtctccagcaaatggtacttcaccactcagagacctagatccacagagg
gatgtgaaggatttttcctacagttcattccacaaggattccaccttgaacctgggtcaa
gagatgaggacagaactagagattgaagaaacgctgttgaatgaaggcgtggccatgaac
tgtgagggccagatagtagtggaaggtgaggaccaggaggaattttgggaagcagccaaa
gaccagcacaagaagaaaaagaagaagacccttgttgccagtctgccccgatctgcagcc
gcagccaggaaggacattggaaacacatcctcctctgacgaagacatggagcattacttt
gacttctcacggacaatagtcagtcattccagatctaaagatcttgccaaatgtccctct
cctccttcctctcgaactctggctcagcttgatggcgttgatgatggcacagagagcgat
gcaagtatagtgacaaatgacgacgcccagaaagtggcccagaatgccaaaaatcctaaa
aacaaaaaattcactggattccaaactgcaaattgcacaaatgctgtccatagtcctgtc
ccggaggcgtcgtcgagtgataagcacaaagattctaatccctacggtgccagagaagat
tcaaaaaaagatctgttaagtgtggataacaagggatttgtttcctcacagttttctgca
gaccaaagctcttgtgtaaatctgccaacaatcccccctactccagtcgacccatcacca
gcgaacactgctggcaatagcaagggtgtcttgcaggatcttctcaagcctccgtcaatt
tctacagaagtacaggcgccctctcatggactgatggattctatgcagatgttcagtcag
tcatctttgactagcattacccttcagccagtaacatgctcacaagagtgtgcaacattt
tcatcaccatccactaagctcaccaccctgaccccagtgggtgacctgacgcaacctcta
tcaaacgtcttccttcaaaatgatccagtgctgtcagcctcttcaggcacacttccctca
gtagaaactgttcctggaaccatttactcctcagacgctcaggcactggtgtccacagcc
gtccccattgtctcttcctctgcatcactgtctgagctgtcaacacccacagctgcacca
ccagcagttcaaaccaccaccacccctgttattctaaatggatacagctcttcctcagtg
cagaaggacactgcctctggacacacgatctccatcaacttctccacgcccagaccagct
ctggagccgcagctgcttgctccccaggctttatccggtcacgccattcttactgtcaaa
gaggtgggcggcccaaacgtcgatcctactcctcacgttctgcttgtgaaccgcctcggg
cagatctttgttaaaaacccagagagcaacactttccaactgcccacccccaactcctcg
tcctacaactgcgtcactcagatcgcaagccttttacagagtaatgcactgtcagccaca
ctggcagcagcaggcaacatgagtgtgcaaacccccgtggcaaacgtggtgcagggagca
gctccgccagttgcacctgtcgagcagaaccccaccactattatgcagctcctcactcat
aacagcaacggtgccgtggcctctgtaaatgtgaagaagccgaagaagaatacaaaagct
tcaaaagatgagactgcactagaattaaaaaagccaaaaaagaagaaggagtccagtgca
cccaaaaaatccaagtcatccaaggccgcaggctcggctgccgtgtccaccccgaaacca
cctgtgactccggcagagagcgctcaagccattatttaccaggccatggcgagcaactac
accccgaagtacagtggcattcgctcgctcagcccttcgtctctcgttttgccacctggc
ttgttaattgaacctgaagagctggagaatctgaagtgtcctcgttctccttcaccacca
ccaccaccagccccaccaccagcactgcctgcaccatctgtgtctgcaccccggcctcgc
acccatgttcgcatgaagagagtgtcttctctctcagaccgtattgtcacgaagaaatct
aaagttgactttttgaaaccagagcctatccacgagcaagaggagcagcagcagccggca
ccggcaccggcaccaccgcagcggcacaaggtcaccccgcagagtgtgtccagcagagct
tcaggagtcaggatcaagactccgacagtgaaaggaatcctgaacctggatgaggtgaag
gaggagcacatgagtgattcagacagcacagggtccaactctttagagttcatgtctcgg
gtggatcaaggtaaacaggtcgtgcgtgaaccagtgggacacaacaatctgaccgactgg
aggaagtattctggtgccgcttctgcttcagatgaggagccaccgatttctgatgaggat
gaggaatttcccaccaacaaagagcagccgcacttacgttttgaaataaccagtgatgat
ggtttcagcgttgaggcagacagtattgaggtggcttggaaggcagtgatcgacggcgtt
caggaagcacgtgccatcacgagactgagaccgctcaccttccagaagatcactggtgcc
ctgatgttcggtctcctccacgatacggtggtgttcttactggagcagctggaaggagct
ccccgttgtcaacgccacaaattccgtttcttcaaacagttcagccaagaagatgatctt
cctgttaatcccagtggctgtgcccgctccgaaatccatctgaggaaatccacctttgac
atgttcaacttcctggcctctcagcacagacagctccctgacattgggccttatgatgat
gaggaggatgagattctgctgaagtccacacggcgggctactagtttggagctgcccatg
gccatgcgcttcagacacctggaacgaacatccaaggaggctgtaggcgtctacaggtct
gcaattcacggccgtggtctgttctgcaagaggaacatcgaagcaggagagatggtgatc
gaatacgcaggcatcgtcatccgctcagttctcactgacaaacgggagaagtactatgat
ggaaagggcattggctgctacatgttccgcatcgatgactttgacgtggtggatgccacc
atgcacggcaacgcggccaggttcatcaaccactcctgcgaacccaactgttactcacga
gtgatcaacgtggaggggcgaaagcacatcgtcatctttgctctgaggaagatctaccga
ggggaggagctcacctacgactacaagttccccatcgaggacgccagcaacaagctgggc
tgcaactgtggagccaggaggtgtcggcgtttcctcaactga

DBGET integrated database retrieval system