KEGG   Cynoglossus semilaevis (tongue sole): 103388534Help
Entry
103388534         CDS       T04866                                 

Definition
(RefSeq) trypsin-3
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:csem00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103388534
Enzymes [BR:csem01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     103388534
Peptidases [BR:csem01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103388534
Exosome [BR:csem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103388534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
13
AA seq 247 aa AA seqDB search
MKAFILLALFAVAYAAPLNDEDDKIVGGYECRKNSVPYQVSLNAGYHFCGGSLISSTWVV
SAAHCYKSRIQVRLGEHNIEVNEGTEQFINSAKIIRHPNYNSRNLDNDIMLIKLSNPATL
NSYVRTVSLPSGCANSGTTCLISGWGNMSSSGSNYPDRLRCLDAPILSDTSCRNSYPGQI
TSNMFCAGFLEGGKDSCQGDSGGPVVCSGQLQGVVSWGYGCAQRNKPGVYAKVCRYTTWI
RSTMSSN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcattcttctggctctgttcgcagtggcatatgctgctcccctcaatgat
gaggacgacaagattgttggaggttatgagtgcaggaagaactctgttccctaccaggtt
tctctgaacgctggctaccacttctgtggaggctccctgatctccagcacatgggtggtg
tctgctgctcactgctacaagtcccgtatccaggttcgtcttggtgagcacaacattgaa
gtgaacgagggcaccgagcagttcatcaactctgctaagatcatccgtcatcccaactac
aacagccgtaacctggacaatgacatcatgctgatcaagctgagcaaccccgccaccctg
aacagctacgtccgcaccgtgtccctgccctctggctgcgctaactctggaaccacgtgt
ctgatctctggatggggcaacatgagcagctctggaagcaactaccctgaccgtctgagg
tgtctggatgcccccatcctcagcgacaccagctgcaggaactcctaccctggacagatc
acctccaacatgttctgtgctggattcctggagggaggcaaggactcctgccagggtgac
tctggtggccccgtggtctgcagcggtcagctgcagggtgtggtgtcctggggctacggc
tgtgcccagaggaacaagcctggagtctacgccaaggtctgcagatacaccacctggatt
cgcagcaccatgtcctccaactaa

DBGET integrated database retrieval system