KEGG   Cynoglossus semilaevis (tongue sole): 103392668Help
Entry
103392668         CDS       T04866                                 

Gene name
setd1a
Definition
(RefSeq) histone-lysine N-methyltransferase SETD1A
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:csem00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103392668 (setd1a)
Enzymes [BR:csem01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103392668 (setd1a)
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103392668 (setd1a)
   HMT complexes
    COMPASS/SET1 complex
     103392668 (setd1a)
    COMPASS/SET1 complex (yeast)
     103392668 (setd1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 103392668
NCBI-ProteinID: XP_008327561
LinkDB All DBs
Position
17
AA seq 2190 aa AA seqDB search
MDPDGGAEAKAFSLQWKSYKLVQDPAIRRVAQKIYRYDGVHFSVPDSGFPPVGELRDPRP
RRLWSRYTELSLPVPKFKLDEFYVGPIPLKEVTFARLNDNIKEPFLGDMCAKFGEVEEME
ILFHPKTRKHLGLARVLFTSTRGAKDTVKHLHNTSVMGTVIHAQLDIKGQQRQKYYDLIV
NGSYTPQTVPLGGKALTDKLQTPAPTQPQPDTSTEIRRRLSSELAVLAAGVQVLTSGNIT
PCSVDTGFTDQRLDTPPPNMSGPYTPGSTASVQSGGGTPYSSRSGTPFSQDSGYAGGRNT
GYSAGTSGSGYPPQDMLPSSSSSSAVSSTVGGYKMSRYPEDAQESTVYHRGRPMYPPTSS
YRPNEPPCYPPYPNMGGPGPHMGLHSSMPPPPASQYDQPTMSDRDRDRDSGGRYGTGGIG
SRRSSYQHQLETNSSSKYHSHHSHHHSERREDRGYRRDSLGSRSGDHSHQRHRNHHHSHN
HHHSSSRRRSSHDRDRDRDRDRERDRDRDRDNDFSNSSDPRYNSNSYRSSSNSMSPPPSS
YSSYSTSKEATAQGMENSSRQGASSFAERTSLSSSGPEKDYHGGHHSALPAPPPPPPPLP
PASVIAAAVAETLGTLDFNQDSPVREEQWTKPKRRPSTPPAPPKTPPPFSPPHPSITSSS
ASPSSTSLPHHLASSSNSPQPPPRDSSSPEPDSTIESVPFAYHSSSLDSRIEMLLKEQKA
KFSFLASDEEDEEDKKEEKRRDSHGDRGERRVNRTGEPTAGYQGGDSGAKDHWKKEERDT
GKKRGKEAEESKSPTVLNSNTPSSSTYSPHIPPPEEAQSHEGPGALSEDSSQAGSADTRT
KTGAHTPPYNGQSQSSPHSSGEDMEISDEEEEATITTVTTHQPTITSGSSPSSSQAALPS
QTVDPSSSPPPLSDSAQHFGSSMHPPMPSYPPHLPPPPPPGYSLQPPPPPGIPPLPHMDL
HPEYPPPIPHNVYDYATSMELMNQYSGGAPMSFQMQTHMLSRLHQLRMSASNGTPGPGEA
ATADYSSYHLHSMAATHTHHPYMDQEGSGAGSHYDQDHRYMPPHMSYSYPDGHSTQIPPP
PHHGIPPPHPTWPPHVLPPQYSSYIPPPGYSTMLSGEGEEYRAPGEEVPLLPESPNEAAV
QVVLATLIQEMKNIMQRDLNRKMVENVAFATFDEWWERKETKAKPFQTMVRGVSALREDE
KKEEKVNRPREPLTSLVDWAKSGGMEGFSLRGALRLPSFKVKRKEPQELEEGDMKRPRPS
TPPDDDGANARRQEVDRRGAERDNKRRKKKQRNRKPWELDSEGEETSDGSSSEKENDEDD
SEKESDDDALSADSDDESLSSSSEGSSSEGSSSSSSEEDEEEEEGERVDSGPDTMDESTM
DSTMEKHDSRNNISAAVPKANIQAGEAKEIKAHTTTEPSKQPPSALHLRPSSPVVLVPPL
KKRRKTVSFSTDENDSKLQMSSAVLPTSPSPVANESPLQSPQESPITAVSTSSTRPSQGI
QLLPFASKPGEGNALIVPPPGRTQDSDESKKGLPISPQTTPVRSPGKKGASKDSPKSPVS
PVMVCRTVQNLPLDHSSMCRMVFEEVPPQPLGNKRSRGRPRTTSLSASSCHSLREEDEEE
GSEQRLRLREQLGASSLLQLASASTTDLSVLADVASKIDHDAGDSEETETSDEAEEQKME
DHLFTPESLALIMNPEGVVIIMEHNYCKPPVLPAAITKRTSTKQDLSLLVPSDLNTISGV
LEAPEEVVGEALPSRGDPAEHFSGMGAHCESEDAAQAAPSPSKKKGIIGKGLELEKDEKK
KKKRKDKENVEVHRTKKQDEAGKKKKKRKQEDSDLEEDVDVEELESGELSSSEPDDEGVE
EVRKSERLFLQEAGLSSSQRWPKPLPAPEPPAQKYDVRSEFEQMTILYDIWNSGLDGEDL
TLLKKTYEKLLQDDHGSDWLNDTHWVNHSVTNLPNPRHKKKNADGQLREHVTGCARSEGY
YAISRKEKDKYLDLDLPEQVIREVENVDSSGVNRVLSERRSEQRRLLTVIGTTAVMDSDL
LKLNQLKFRKKKLRFGRSRIHEWGLFAMEAIAADEMVIEYVGQNIRQMVADNREKRYAQQ
GIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIAVN
EEITYDYKFPLEENKIPCLCGTENCRGTLN
NT seq 6573 nt NT seq  +upstreamnt  +downstreamnt
atggatccagacggtggggcagaagcaaaagctttcagtttgcagtggaaaagctacaaa
cttgtccaggatcctgctatcaggcgggttgcacagaaaatctacagatatgatggtgtg
catttcagtgtgccagactctggatttcctccagtgggtgaactacgtgacccaagaccc
aggaggctgtggtccagatatacagaactgtccctgccagtgccaaagtttaagcttgat
gagttttatgtgggtcccatacctcttaaagaggtgacctttgccagactaaatgacaac
ataaaggagcctttcctgggtgacatgtgtgccaagtttggggaagtcgaggagatggag
attctgtttcaccccaagaccaggaagcacttgggtctggccagggtgttgtttaccagc
accaggggagccaaggatacggtcaagcatctacataacacctctgtcatgggtaccgtc
attcatgcccaactggatataaaggggcagcaaaggcagaagtattatgacctaatagta
aatgggtcttacactcctcagactgtgcccctgggaggcaaagctttgacagacaagctg
cagaccccggctccaacacaaccacagcctgacacgtcgacagaaatcaggcggaggctc
tcaagtgagcttgccgttttggcagcaggggttcaagtcctcacatcggggaacattact
ccttgctctgttgacactggcttcactgaccaacgtctggacacacccccacccaacatg
tcaggtccatacaccccaggctccacagcttcagtgcagagtggtgggggaactccttac
agttcaagatctggaactccgttctcacaagactccggttacgcaggtggcagaaatact
ggctacagcgctggcacttcaggcagcggctaccctccccaagacatgttaccatcctcc
tcctcgtcttctgcagtctcatctactgtcggaggatacaaaatgtctcgctaccctgag
gatgcacaggagtctacagtgtatcatcgcggtcgacccatgtatcccccaacctcatcg
taccgtcccaatgagccaccatgctatcccccatacccaaacatgggaggacctggtcca
cacatggggctccattcttcaatgcccccaccacctgcaagccaatatgatcagcccaca
atgtcagacagggaccgagacagagactcaggtgggcgttatgggacaggaggtattggt
tccagaaggtcatcctaccaacaccagctggaaacaaactcttcttcaaaataccactcc
catcactctcaccaccattcagaacgcagggaggacagggggtaccggcgggacagtttg
ggctctcggtcaggtgaccacagccaccaaagacaccgcaatcaccaccattctcacaac
caccaccacagcagcagtcgcagacggagtagccatgaccgggacagagacagagatcga
gacagagagcgggatcgggatagagatagagacaatgacttctccaacagctctgaccct
agatacaattccaactcttatcgctcttcttctaacagcatgtctcctccaccctcatct
tactcttcttactcgacatccaaagaggccacggctcaagggatggagaattccagccga
caaggagccagtagttttgcagagaggacctctttgtcctccagtggtcctgagaaagac
tatcacggtggtcaccacagtgctctgcctgcacctccaccaccaccaccgcccctccca
ccagcttctgtcattgctgctgctgtagctgaaactcttggaacacttgacttcaaccag
gacagcccagttcgagaggagcagtggacaaaacccaaacgccgccccagcaccccacca
gctcctccaaagactccacctcctttttctccaccccacccctcaataacttcttcctcc
gcctctccttcttccacctcactccctcatcaccttgcttcttcctctaattccccacaa
ccccctccacgtgactcctcttcaccagaaccagattccaccattgagagcgtaccattt
gcctatcacagcagcagtcttgactcccgtattgagatgcttctgaaggagcagaaggct
aaattttctttccttgcctctgatgaggaagacgaggaggacaagaaagaggaaaaaagg
cgagactcacatggggacagaggagagcgaagagtcaatcggactggggagcccacagct
ggttatcagggcggagacagtggggctaaggaccattggaagaaagaagaacgagacaca
ggaaagaaaaggggtaaagaagcagaggaaagtaaaagtcccacagtactgaactcaaac
acaccttcctcttccacctattctccacacatccctccaccagaagaggcccagtcccat
gaaggacctggggctttaagtgaggattcatcacaggctggatcagctgatacacgcact
aagacaggggcacacacaccaccttataatggacagagtcagtcctcccctcattcctca
ggagaagacatggagatatcagatgaggaggaagaagccacaataacaacagtgacaact
catcaacccaccatcacctcggggtcctcaccctcttcatcccaggctgctttgccttca
caaacagtcgacccctcatcctcaccaccacccctttctgactctgcacagcactttggc
tcctccatgcaccctccaatgccatcttaccctcctcatttaccccctcctcctcctcct
ggttattctctacaacctccacctcctccaggaatccctccccttccccacatggatctc
catccagagtatcctcctcctatcccccacaatgtctatgactatgccacctccatggag
ctgatgaaccagtacagcggtggtgctcccatgtcttttcagatgcagacccacatgcta
agtcgtctacaccagctacgcatgtcggcatctaatggcacaccaggccccggagaggct
gccactgctgactactcctcctaccatctacactcaatggcagcgactcacacgcatcac
ccttacatggaccaagaagggagcggggcgggcagtcattatgaccaagaccatcgttac
atgccccctcatatgtcctattcttaccctgatggccacagcactcagataccaccccct
ccccaccatggcatcccacctcctcaccctacctggcctccacatgtcttaccaccacaa
tattcctcctatattcccccacctggttatagcaccatgctatctggagaaggcgaggaa
tacagggctccaggggaagaggtgcccctgctgcctgagagtccgaatgaggccgcagtg
caggtggtcctggccactctgatccaggaaatgaagaacatcatgcagagggacctgaac
cgcaagatggtggagaacgtcgcctttgctacattcgatgagtggtgggagaggaaagaa
actaaagccaagccgttccagaccatggttcggggggtgtctgccctgcgagaggatgag
aagaaagaggaaaaggtcaaccgtccacgagagcctctcacatctttggtggattgggcg
aaaagtggtggcatggagggcttttctctaagaggagcgcttcgtctgccttcatttaag
gtgaagaggaaagaacctcaggaactagaggagggagacatgaagaggccacgaccttca
accccaccagatgatgatggtgccaatgcgagaaggcaagaggtggacaggcgtggagct
gagagggacaacaagaggaggaaaaagaagcagagaaatcgcaaaccctgggagctcgat
agcgagggagaggaaacatcagatggttcgtcgagtgaaaaggaaaatgatgaagacgac
agtgaaaaggagtctgatgatgatgctctcagtgctgacagtgatgatgagagtctgtct
tcatcctcggaggggtcttcctcggaggggtcttcatcctcatcctcagaagaggatgag
gaagaagaggaaggagaaagagttgacagtgggccagacaccatggatgagtcaaccatg
gacagcacaatggagaagcatgacagccggaacaatatttcagcagctgttccaaaggca
aacattcaagcaggtgaagcaaaggaaattaaggcacatacaacaacagaaccttcgaag
cagccaccatctgcactacatctacggccttcctcccctgttgttctcgtgcccccactc
aaaaaacgcaggaaaacagtttccttctctacagatgagaatgacagcaaactgcaaatg
tcatctgcagtgctgcccacatctccttcaccagtggctaatgagtctccactccagtct
ccccaggagtcacccatcactgctgtctcgacctcctccactcgtccgagccaaggtatt
cagcttcttccctttgcctcaaaaccaggggaaggcaatgccctcattgttcctccacct
ggaagaactcaagattctgatgaatccaaaaagggacttcctatttctcctcaaaccact
cctgtcagatcacctggcaaaaaaggtgcgagtaaagactctccaaaatctcctgtgtct
ccagtcatggtgtgtcgcactgtgcagaatctgccgttggaccactcttctatgtgcagg
atggtctttgaggaggtcccccctcagcctctgggtaataaacggtccagaggcagacct
cggacgacaagtttgtcagcttcgtcctgtcattcgctcagagaggaagatgaagaggag
ggaagtgaacagaggctaagactcagggagcagcttggagcatccagccttctgcagctg
gcttcagcctccaccactgatctgtcagtgttagctgacgtagcctccaaaattgaccat
gatgctggagactcagaggagacagagacatctgacgaggcagaggagcagaagatggaa
gaccatctcttcaccccagagtctctggccctcattatgaaccccgagggtgttgttatc
ataatggagcacaactactgcaaaccccctgttctcccagcagccatcaccaaaagaact
tccaccaaacaagacttgtctctcctggtcccatcagacctcaacaccatttctggagtt
cttgaggcaccagaggaggttgttggagaggcattaccatccaggggggatccagcagag
catttctctggaatgggggcacactgtgagtcagaagatgcggcccaggctgctccatct
ccatcaaagaagaaaggcataattggcaaaggtttagaacttgaaaaggatgaaaagaaa
aaaaagaaaagaaaagataaagaaaacgttgaggttcatcgcacaaagaaacaagacgag
gcaggaaagaaaaagaagaagcggaagcaggaggactcagacctggaggaagatgtagat
gtagaggagcttgagtctggagagctctccagctcggagccagacgatgagggagttgag
gaagtcagaaagagtgagcggctcttcctccaggaggctggactatcctcgtctcaacgc
tggcccaaacctcttccagcacccgagccaccggcccagaagtatgatgtgcgtagtgag
tttgagcagatgaccatcctgtacgacatctggaactcaggtctggatggtgaggacttg
acgttgctgaagaagacctatgagaagctattacaggatgaccatggctctgattggctc
aatgatactcactgggtcaaccactcagtaaccaatttgcccaacccacggcataagaag
aaaaatgcagacggtcaactacgagagcatgtgaccggctgcgccaggagtgagggctac
tacgccatcagccgcaaggagaaggacaagtatctggacctggatctgcctgagcaggtt
atacgggaggtggagaacgttgattcttctggagtgaacagggttctgtcagagagacgc
tcagagcagcgccgactcctcacagtcatcggcaccacagccgtcatggactctgacctg
ctgaaactcaaccagcttaagttccgcaagaagaaacttcgctttggacgcagtaggatt
cacgagtggggccttttcgccatggaggctattgctgctgatgaaatggtcattgaatat
gtgggtcagaacatcagacagatggttgctgacaatagagagaaacgttacgcacagcag
ggcatcgggagcagctacttgttcagagtggaccacgacaccattatcgacgctacaaag
tgtggaaacctggcccgattcatcaaccactgctgcaccccgaactgctacgccaaggtc
atcaccatagagtctcagaaaaagattgtgatctattccaagcagcctatcgcggtcaac
gaagaaatcacctacgactataaatttcccctagaggagaacaagatcccatgtctgtgt
ggaacagagaactgccgcggcacactgaactaa

DBGET integrated database retrieval system