KEGG   Cynoglossus semilaevis (tongue sole): 103394569Help
Entry
103394569         CDS       T04866                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASH1L-like isoform X1
  KO
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:csem00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103394569
Enzymes [BR:csem01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103394569
Chromosome [BR:csem03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103394569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
18
AA seq 2948 aa AA seqDB search
MDQKMQGGSSAPPPLISATSSGERDKEGGGGKKEEEDEKQRDREKEGSNNVSSGNGCAGA
DAPGGAGGDQSHFSIKESSLCEGNVKLKIGLQAKRMKKPPKILENYVCRPAFRATVRHTG
RGGGSARGNRATTVNDGSSNQSQSPSQGKDKEREKSPSINKQPSSSSSTPSLKAPTPPPP
PVSTPPSANMSPSPGIGNTLAKKGPPKIDCKSDTKPDTKAAATNSERPLNLHRPPLDSKT
HSSGKKALTPQLNPRTSSPSPPQPASIEPSFEGVKPPQYTYSTENQRDKDKGVQNWGTPT
VTEKLAQLIATCPPSKTLKPAKPTKIEPAPSPPSPGFMAPTAKQRDRALANRNTYSRIVH
LSPPPPVSRPPGRPYGSRNKDSVMDSSPSLTPLRKEDADVSGKTSNNSVTFSNSINMNST
ITSSRSSSPALTFVSNRLSPLSKDSTNENSSISKPHSRPAHSQPNNGNLSSCPSFSTSSI
EQRTSVVSHLGSPSHGYHAAESSALAEESSESEKEQDRDIPRDLTKCPHLTGMGKLEGKD
KGGHYHSMRIERGKSSSPSKRSPNRESNRPGRTLSPPESVRQRAPSPPEPEDEDSRPHTP
YRDDSPDSSIDSPAEQDRKPLKKRRGRKPRWNRIFNNTESQKRDQNSPFDQSRTTMSISS
SSEIHLPHVKRPVGRPPNPNKVKPTNHSVPQSQVSQLFPLQLKKRGRPKSKMPTLHAPAH
GQPPNKLVPSKVFSSFLKSKEEQDPPVLHPEVDFNPPKPMPRKRGRPKRLPPTLPQEGQP
PTLAPEAGEMGDKRFCSKGNGQLIMKTIIGKINKMKSVKRKRILSQILLGPRPEDTPKCN
SSGVAGSVEATSQLSSLAASFGGKLGSQINVSKKGTIYMGKRRGRKPKTSSNSTATSPSE
PFLSPNTNSPHHHHQQSHQHHQFSSSEVFPSPSLSQSSGGHSPISDASFVEPSSVHFVGH
SHYSNSHHNHNTFSFPPPTFSAPNPRNTGLGMTSSSMTTAASQKKSSCRGYHHHHHHYRQ
HFHYHKLSPPRPLHPTSPAPLSELKEATPSPVSESHSEETVPSDSGIGTDNNSTSDRGEK
AGGVGGLGAIGIPPGIGSGILMPGVMGSSMGPGLNSRGRRRHSAVLMERPSPSPSPHGTR
TPPDPRRPHPAAPASSLIGHKEKHKHKCKRRSHGCPGYDKLKRQKRKRKKKYLQLRSRRL
DPDFLAELDEIVVRLSEVRITHRTTGHRLGSVVGIGAGTSRIQGVGSRASSGIGGAGGPP
PHHYVHRDLLPTIFRVNFGSYYSHPAYSHCDPLHYVRKPDLKKKRGRPPKLRDSMSDVPF
VPGLGFPLSSGGFYHPSYSVPYSSGPLGLGYYRGYPTASALYPHPHHQSPHTASSHHSHH
SPTFPPPPPTSYVHHHPSHLLLNPSKFHKKKHKLLRQEFLGGGRAPVLYPPMSSELSFNW
HHKHKHRHKHRERCADDDREEGARSGSGSRSNAGMSDSRTSGKGERVSSMGMAESLQRCR
FGRDASSTSTSKQPGSANSPSSSSTSSAERCKRKESSLSCLGPSRLAVGNSSKGHHPIES
WFRMGNSEAEYPKLSRSHVLSGQGPFSDGRTENPAACTDSEDEEPLTPTEEGEPGGHNSP
NLTNLFASALTRTALKGSRNRKTEAECSGFSNMDRPKSKDRSTSAERRDMGSTSVQSKGA
ALSTSDGPEGSLQHRQQHHHQTSLFYPHGSTSSSSCLSPAQDYCLGASLPHHSHRAQPSK
HSLHHVNKILRAKKLQRQARTGNNVVKKRGPGRPRKHPLPSPPPSPTPVVEVTQARHRDR
VLEQPAGDSVWDGDTVTDAIESVVQGQRRKGQKRKHWERNGDEEEEEEDGEVQESEDPLP
NSEENLGDLMARSTTGTGRVWLTQEELQHFRGSMESKPDGHCSPERPGTVSREQAPPISI
TSQREKRAARPPKKKFQKAGLYSDVYKTEDPKSQLLQLKKEKLEYIPGEHEYGLFPAPIH
VGKYLRMKRIDFQLPYDILWLWKHDQLHKRPDVPLYKKIRSNVYVDVKPLSGYETTTCNC
RPSDNTPEKGCLDDCLNRMSFAECSPSTCPCAETCDNQHIQRHEWVQCLERFRTEGKGWG
IRTKETLRSGQFIIEYLGEVVSEQEFRSRMMEQYFSHSGQYCLNLDSGMVIDSYRMGNEA
RFINHSCEPNCEMQKWSVNGVYRIGLFALKDISSGTELTYDYNFHSFNTEEQQVCMCGSE
SCRGIIGGKSQRINGLPGKNGGARRLGRLKEKRKSKHQLKKREEESSDSNKFYPHLMKPM
SNRERNFVLKHRVFLLRNWEKMREKQELLKREGERERDSSSLSIYTRWGGVIRDDGNIKS
DVFLTQFSALQTSRSVRTRRLAAAEENTEVTRTARLAHIFKEICDMITSYKDSSGQTLAA
PLVNLPSRKRNSQYYEKVSDPLDLSTIEKQILTGHYKTVEAFDADMLKVFRNAEKYYGRK
SSVGRDVCRLRKAYYSARNEAAVQIDEIVGETASEADSSDSLERDHGHHHGSAGSHDKDD
DVIRCICGMYKDEGLMIQCEKCMVWQHFDCMRLETEAEHYLCEQCEPRPVDSEVPMVPQP
SYAQAGSIYYICLLRDELLLHQGDCVYLMRDSRRTSEGQPVRQSYRLLSHINRDKLDIFR
IEKLWKNEKGERFAFGHHYFRPHETHHSPSRRFYQNELFRMPLYEIIPLEAVVATCCVLD
LYTYCKGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYAFNHFPKRLTPKRD
FSPHYVPDNYKRNGGRSAWKSERPKGPGGEDDVSSCDRGDDFPPEAEEERGAEDDMEVAQ
EDPRLLAAKPKRTEQEDEEEDDEEEEAQEAEGHKEMEADSTERIGEMLELPSSSASSPLH
HPALGRREAQRERLNKILLDLLHRTPNKNGEAPGTKQGAIDVTYLLEEGAGRRLRRRTLG
FGDFVGRK
NT seq 8847 nt NT seq  +upstreamnt  +downstreamnt
atggatcagaagatgcagggaggatcttcagctcctccccctcttatctcagctacttcc
agtggtgaaagagacaaggagggaggaggagggaaaaaagaggaagaggatgaaaagcag
agagacagagagaaggagggatctaacaatgtctcaagtggtaatgggtgtgcaggtgca
gatgctccaggaggtgctggtggcgaccaatcacatttctccattaaagagagcagcctg
tgtgagggcaatgtcaaacttaagattggtcttcaagctaaacgaatgaagaaaccaccc
aaaatcctggagaattatgtgtgtcgaccagccttcagggccactgttcggcatacaggg
cgcggtggaggaagtgcacgtggaaatcgtgcaacaactgtaaatgatgggtcaagcaat
caaagccagagtccatcacaaggcaaggataaagagagggagaagagtccatctatcaac
aaacagccctcatcatcctcatcaaccccttcactcaaagctcctacaccaccaccacct
cctgtttctactccaccttctgccaacatgtctccctccccaggaatcgggaatacttta
gcaaaaaagggtccaccaaagattgactgcaagtctgacacaaagccagacacaaaagcc
gcagccaccaattctgagagaccccttaaccttcaccgccctcctctagacagtaaaaca
cattcctctgggaagaaagcactgactccacaactcaacccaaggacatcctcaccttct
ccaccacaacctgcatcaatagaaccaagctttgaaggtgttaaaccccctcagtacacc
tacagcactgaaaatcagagagacaaagacaaaggtgtccagaactggggaacgcctaca
gtcacagagaagttagctcaactcatagcaacatgcccaccatcaaaaaccttaaagcca
gccaaacccacaaagattgaaccagccccttcacccccaagcccaggctttatggcccca
acagccaaacagcgtgacagggctttggccaataggaacacatactcaaggattgtccac
ctttctccacctcctcctgtatcacgaccacctggtcggccctatggttccagaaacaaa
gacagtgttatggacagttcacccagcttgacaccactgagaaaagaggatgcagatgtg
agtggaaaaacaagcaacaacagtgttaccttcagcaacagcatcaatatgaatagcacc
atcaccagtagtcgtagcagcagcccagcactcacttttgtcagtaaccgcttgtcaccg
ttgtcaaaagatagcaccaatgagaacagtagcatttctaagccacattcacgtcctgct
cacagtcaacccaacaatggaaacttgtcctcatgtccatcctttagcaccagttcaatt
gagcagaggacaagtgtagtgagtcacctgggttctccctcacatggataccatgcagca
gaaagttctgctcttgctgaggaaagcagtgaaagcgaaaaggagcaagacagggacatc
cccagagacttaacaaaatgccctcacctaacgggaatgggaaagttagaaggaaaagac
aaaggaggtcattatcattcaatgcgaattgaaaggggaaagagctctagtccaagcaag
cgaagcccgaaccgagaaagtaatcgacccggtcgtactttgagccctccagagtcagtt
agacaaagggcaccttctcccccggagccagaggatgaggacagtcgtccacatacacct
tacagagatgattctccggattcatctattgattccccagctgagcaagacaggaaacct
ctgaaaaaacgcagaggaaggaagccacgctggaaccgaatttttaacaacacagagagt
caaaaaagagaccagaacagtccttttgaccagagcagaaccaccatgtctatatcgtca
agctcagaaatacatttgccacatgtgaaaagaccagtgggtaggcctcctaacccaaat
aaagttaaaccaaccaaccattctgtgccacaaagtcaagtgtcacagcttttcccactg
cagcttaaaaaaaggggaaggccaaagtccaaaatgccaacacttcatgcccctgctcat
gggcaaccaccaaataagctggtcccttctaaggtcttctcttcttttctcaagtccaaa
gaagagcaggacccacctgtccttcacccagaggtagattttaaccctcctaaaccaatg
cctagaaaacgaggacgcccaaagcgccttccccctaccttaccccaggaaggtcaacct
cccacattggctccagaggcaggagagatgggagacaaacgtttctgcagtaaaggaaat
gggcagcttatcatgaaaactattataggtaaaatcaacaaaatgaaaagtgtgaaaagg
aaacgcattctcagtcaaatcttgttaggcccaagaccagaggacaccccaaaatgcaat
tcaagtggagtggctggctctgtggaagccactagccaattatcctccttagctgcttca
tttggggggaaattggggtcacaaattaacgtcagcaaaaaagggacaatttatatgggt
aaaaggaggggccgtaaaccaaaaacatcaagtaattccacagcgacatcaccatcagaa
ccattcttatctccaaacaccaattcccctcatcatcaccaccagcaatcccatcaacac
catcagttctcctcttcagaagtctttccctccccgtccctttcacagtcaagtggaggc
cacagtcccattagtgatgccagctttgttgagccaagctcagtgcactttgtgggtcat
tctcactattccaactctcatcataaccacaacacattctcttttccacccccaaccttt
tcagctcctaatccccgcaacacagggttaggtatgacatcatcatccatgactacagca
gcttcccagaagaagtcatcttgccgtggataccatcatcatcaccaccattacagacag
cactttcactatcataaactttcccctcccaggccacttcatcccacttccccggccccc
ctcagtgagctcaaagaagccactccatcaccagtcagtgagtcacacagtgaggagaca
gtgcccagtgacagtggtattggaacagataataacagcacttctgaccgtggtgagaaa
gctggtggagtgggtggcttaggtgcaattggaataccaccaggaattggcagtgggata
ctaatgcctggggtcatgggatcatctatgggtccaggccttaattctagaggcaggcga
agacactctgctgtgcttatggaacgcccctcaccctctccatcacctcatgggacaagg
acaccgcctgatccccggagacctcacccagcagcccctgcctcgtcgttaataggacac
aaagaaaagcataagcacaagtgtaaacgccgcagccatggatgccctggttatgacaaa
cttaaaagacagaaaaggaaacgaaagaagaagtacctgcaactacgctcccgtcggcta
gaccctgattttcttgcggagctggatgagattgttgtaagactgagtgaagtacgtata
acacaccgtacaacagggcaccgacttggtagtgttgttggcataggagcaggaacaagt
agaatacaaggggtggggagcagggccagttctggcataggaggcgcaggtggccctcct
ccacatcattatgtccacagggacctcctgcctacaattttcagagttaactttggcagc
tattactcccatcctgcatactcccattgtgacccattgcactatgttcgcaagccagat
ttaaagaaaaaacggggaaggcctcccaaactgagggattctatgtcagacgtccccttt
gtacctgggcttgggttcccactttcaagtgggggcttttaccacccctcatacagtgtt
ccttactcctcaggacccctgggtttaggctattatagaggctatcctacagccagtgca
ctgtatccccatccacaccatcagtcaccccacacagcctcatctcaccactctcatcac
tcaccaaccttccctcctcctcccccaacttcctatgtgcatcatcatccgtcacatctc
ttgctgaacccctctaaatttcacaagaaaaagcataagctactcaggcaggagtttctt
ggaggaggaagagcccctgtcctttacccacccatgtcctctgagctctcctttaactgg
catcataaacacaaacacagacacaaacacagggagcgctgtgctgatgatgacagggag
gaaggagcaagaagtggatcaggaagcagatctaatgcagggatgtctgatagcagaaca
tcagggaaaggtgagcgagtgagcagcatgggaatggctgagtctttacaaagatgtcgc
tttggaagagatgcctccagcactagtactagcaagcagcctggttctgctaattcccct
tcttcatcctcaacttcatctgcagaaaggtgcaagcgcaaagagagctcactgtcctgc
cttggtccctccaggcttgcagtgggaaatagctcaaaaggccatcacccaatagagtcc
tggtttaggatgggaaactctgaggcagaataccctaaactctctaggagtcatgtgttg
tctggccaaggtcccttctcagatggacggactgaaaacccagctgcttgcacagacagt
gaggatgaggaacctctcacacctacggaggagggagaacctggaggccacaactcccca
aaccttaccaatctctttgcctctgctctcactcgtactgcactaaaggggagcagaaac
agaaagactgaggcagagtgttctggcttctccaacatggatagaccgaagagcaaagac
cgatcaacatcagcagaaaggagagacatggggtcaacaagtgttcagtcaaagggtgct
gccctctcgacttctgatgggcccgaaggatccctgcaacacaggcagcagcatcatcac
cagacttctctgttttatccacatggctctacttcctcctcctcctgcctttctcctgct
caggattattgtctgggtgcctccctgcctcaccactcccatcgggcacagccatccaaa
cacagcctgcaccacgtcaacaaaatcttacgtgccaagaaactgcagagacaggcccgt
acaggaaacaatgtggtaaaaaagaggggccccgggcgtcccaggaaacaccctttaccc
tctccacccccttccccaacccctgtcgtagaggtgactcaggcccggcacagagacaga
gtgcttgaacagcctgcgggggacagtgtttgggatggggatactgtgacagatgccatt
gagtcagtcgtccaagggcagcgtaggaaaggccagaagagaaagcactgggagagaaat
ggagatgaggaagaagaagaagaggacggggaggttcaagagtctgaggacccactgcca
aacagtgaggagaacctgggtgacctcatggcacggtccacaaccgggacagggagagtc
tggcttactcaggaggagcttcagcactttcgtggatcaatggaaagcaagccagatggc
cactgctcaccagaacgcccaggcactgtctccagggaacaagctcctcccatttccata
acgagccaacgggagaagagagcagccaggcccccaaagaagaagttccagaaggcggga
ctgtactcagatgtgtacaagactgaagatcccaaaagtcaactgttgcagctgaagaaa
gagaagctggaatacatacctggggaacatgagtatggactgtttccagctccgatacac
gttgggaaatatctgcgaatgaagcgcattgatttccagttgccttatgacatcttgtgg
ttgtggaaacatgatcagcttcacaagaggcctgatgttcccctttataaaaagatcagg
tcaaatgtctatgtggacgtcaagcctctgtctggttatgaaacaaccacatgcaactgt
agaccttctgacaacacgcctgaaaagggctgtctggatgactgtctaaacaggatgagc
tttgccgagtgttctcccagtacatgtccatgcgccgagacgtgtgataaccagcatatc
cagagacatgagtgggtacagtgtctggagcggttccgtactgaaggaaaaggctggggc
atccgcaccaaggaaaccctccgctctgggcagtttatcatcgagtacctgggagaggtt
gttagtgagcaggagttcaggagccgcatgatggagcagtacttctcccacagtggccag
tactgtctgaatctggatagtggtatggtgattgacagctaccgaatgggcaatgaggca
cgcttcataaaccacagctgtgaacccaactgtgagatgcagaagtggtcagttaatggg
gtgtacagaattggtctgtttgctctcaaggacatcagcagtggcactgagctcacctac
gactacaacttccactccttcaacacagaggagcagcaagtgtgcatgtgtggctcagag
agctgccgaggcatcattggagggaagagccagcgtattaatggcctgccaggaaagaat
ggaggggcccggcggctgggtcgactgaaggaaaagaggaaatccaaacaccagctaaag
aaaagagaggaagagtccagtgacagcaacaagttttaccctcatctcatgaagcccatg
tccaaccgagagagaaactttgtgttgaagcaccgtgtctttctcctgaggaactgggag
aagatgagggaaaaacaggagctgctgaagagggagggcgagcgagagagggacagtagc
agcctgtccatttatacacgctggggaggcgtcatacgtgatgatggcaacattaaatca
gatgttttcctcacccagttctcagccctccagacatcgaggtcagttcgcacacggaga
ctggctgctgcagaggaaaacacagaagtcacacgcacagctcgcctcgcacacatcttc
aaagagatctgtgacatgatcaccagctataaggattcctctggtcagacacttgctgct
ccactggtgaaccttccgtctcgaaagaggaatagtcagtattatgagaaagtgtccgac
cctctcgacctgagcaccatcgagaagcagatcctcacgggtcactacaagaccgttgaa
gcgtttgacgcagacatgctcaaagttttccgcaatgctgagaaatattacggaaggaag
tcatcggtgggcagagacgtgtgccgtttacgcaaggcttactacagcgctcgtaatgaa
gctgctgtccagattgatgagatcgtgggcgagacggctagtgaggcagacagctcagac
tcactagagagagaccatggtcaccaccatggaagcgcagggtcccatgacaaggacgat
gatgtcatccgttgcatctgtgggatgtacaaagacgaaggcctgatgatccagtgtgaa
aagtgcatggtatggcagcacttcgactgcatgcgacttgagacggaggcagagcactac
ctgtgtgagcagtgtgagcctcggcctgtagacagcgaagttcctatggtaccccagccc
agctatgctcaggctggatcaatctactacatctgcctcctgagagatgaactgctgctt
caccaaggtgactgtgtctacctgatgagagacagcaggcgcacatcggagggacaacct
gtcagacagtcctaccgtctcctgtcccacataaaccgagacaaactggacatcttcaga
atcgagaaactctggaaaaatgaaaagggcgagaggttcgcctttggccatcattacttc
cgtccccatgagacacatcattctccatcaaggcggttctaccagaacgagttgttccgc
atgcctctctacgagatcatccccctggaggcagtcgtggcaacctgctgtgttttggat
ctctacacctactgcaaaggacgaccgaagggtgtaaaagagcaggatgtttacatctgt
gattatcgcctggacaagtcggctcatctcttttacaagatccatcgtaaccgctatcca
gtctgcaccaagccatatgcctttaaccatttccccaaacgtctcacacctaaaagagac
ttctcgccacattatgttcctgacaactacaagaggaatggaggtcgctctgcctggaag
agtgaacgaccaaaaggccccggaggcgaggatgacgtctcttcatgcgacagaggtgac
gactttccacctgaggcggaggaggagaggggagcagaggatgacatggaggtggcgcag
gaggaccctcgacttcttgcagcaaagcctaaaagaactgagcaggaagatgaggaggaa
gacgacgaggaagaggaagcccaggaagctgaagggcacaaagaaatggaagcagattcc
acagagaggatcggcgagatgctggaactgccttcatcctccgcatcctcaccgttacat
cacccagccttgggcaggagggaggcgcagagggagcgcctcaacaaaatcctgctggac
ctgctgcacagaactcccaacaagaatggtgaggcaccgggaacaaagcagggggccatt
gatgtcacttacctcctggaggagggcgcagggaggaggctacggagacggacgcttggt
tttggtgattttgttgggaggaaataa

DBGET integrated database retrieval system