KEGG   Cynoglossus semilaevis (tongue sole): 103395284Help
Entry
103395284         CDS       T04866                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00590  Arachidonic acid metabolism
csem01100  Metabolic pathways
csem04370  VEGF signaling pathway
csem04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    103395284 (ptgs2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    103395284 (ptgs2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    103395284 (ptgs2)
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103395284 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase Phage_F
Motif
Other DBs
NCBI-GeneID: 103395284
NCBI-ProteinID: XP_008331166
LinkDB All DBs
Position
2
AA seq 607 aa AA seqDB search
MNRQTLSVFLLALGFLVCEGGNPCCSQPCENRGVCTALGSDYECDCTRTGYYGQNCTTPE
LLTLIKVYLKPSPNTVHYLLTHFKGFWNIINSISFLRDAIMKYVLTSRSNMIDSPSTYNS
DYDYKNWEAYSNISYYTRALPPLPEDCPTPMGVVGKKELPDAKVLAEKLLMRREFITDPQ
GTSLMFGFFAQHFTHQFFKSDMKKGPAFTLATGHGVDLSHVYGNDLQKQHKLRLFKDGKL
KHQVLNGEVYPPTVKETGVHMIYPPHIPESQRFAVGHEAFGLVPGLMMYAVIWLREHNRV
CDVLKEVHPDWDDERLFQTTRLILIGETIRIVIEDYVQHLSGYNFKLKFDPELLFKEQFQ
YQNRIASEFNTLYHWHPLMPDTFRVGETHYNYKQFIFNNSVVIEHGINKMVESFTNQISG
RVAGGRNVPVPILYVTVETIEHNRKLRYQSLNAYRKRFNMKPYSSFEDLTGETEMAALLE
EMYGHVDAVEFYPGLLVEKPRPNSIFGETMVEVGAPFSLKGLMGNPICSPEYWKPSTFGG
KVGFEIVNTASLQNLVCNNVRGPCPVASFQVQNIKETEPVIINSSTSQSQGSDINPTVIL
KETSTEL
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgaacagacagacactctcggttttcctgttggcgctgggctttcttgtttgtgaagga
ggtaacccatgctgctcacagccgtgtgagaacagaggcgtgtgcacggcacttggaagt
gactatgaatgtgactgtactcgcactggatactatggacaaaactgcaccacacctgag
ctcctgacactgataaaggtttacctgaaaccatcgcccaacactgtccactacctgctc
acccacttcaagggcttctggaacatcatcaacagcatctcttttctccgggatgccatc
atgaaatatgtgctgacatcccgttccaatatgattgatagtccttcaacttataattca
gattacgattacaaaaattgggaagcctattctaacatctcatactatacccgtgccctc
cctcctttacctgaggattgccccactcctatgggtgtcgtaggtaagaaagagcttcct
gatgccaaggttttggctgaaaagctcctgatgagaagagagttcatcacagatccacaa
ggaaccagcctgatgtttggattctttgcacagcattttactcaccaattcttcaaaagt
gacatgaagaaaggacctgcttttactctggcaacagggcatggggtggacctcagccat
gtttatggtaacgacctgcagaagcaacacaagctcagactgttcaaggatggcaaactg
aaacatcaggtcttgaatggagaggtttatcctccaacagtgaaggaaacgggtgttcat
atgatctaccctcctcacatccctgagtctcagcgctttgctgtgggccacgaggccttc
ggcctggtccctggcctgatgatgtatgctgtcatctggctacgggagcacaatcgagtg
tgtgacgtgttgaaggaagtgcaccctgactgggatgacgagagacttttccaaaccaca
aggctcattctgattggtgagaccatcaggattgtgattgaagattatgtgcagcacctg
agtggctacaacttcaagctgaagtttgaccccgagcttctcttcaaagaacagttccag
taccagaaccgcatcgcctcagagtttaacacactctatcattggcaccccctgatgccg
gataccttccgtgtcggggagacacactacaattacaagcagtttatcttcaacaactct
gtagtgatagagcatggcatcaacaagatggtggagtcgtttaccaatcaaatttcagga
cgggttgctggtggccggaacgttcctgtgcctattctgtatgtgaccgttgagacaata
gagcacaacagaaaattgcgttaccagtccttaaatgcctacagaaaacgtttcaacatg
aagccctacagctcttttgaggacctgacaggagagacagaaatggcggcattgctggag
gaaatgtacggacatgtcgacgctgtagagttttaccctggccttcttgtggaaaaaccc
agacctaattccatctttggggagaccatggtggaggtaggggctcctttctccctgaag
ggactgatggggaatcccatctgctccccagagtactggaaacccagcacctttggtgga
aaagtaggctttgaaatcgtcaacacagcctctttgcagaatctcgtctgcaacaacgtt
cgtggcccctgtcccgtggcatcttttcaggtgcaaaacataaaagagacggagcctgtg
atcattaactccagcacatcccagtcacagggtagtgacatcaaccctacagtcatttta
aaagagacaagtacggagctgtaa

DBGET integrated database retrieval system