KEGG   Comamonas serinivorans: CCO03_13240Help
Entry
CCO03_13240       CDS       T04892                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cser  Comamonas serinivorans
Pathway
cser00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cser00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CCO03_13240
Enzymes [BR:cser01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CCO03_13240
Transporters [BR:cser02000]
 Other Transporters
  Pores ion channels [TC:1]
   CCO03_13240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_N_4 GST_C
Motif
Other DBs
NCBI-ProteinID: ARU05521
UniProt: A0A1Y0EQ46
LinkDB All DBs
Position
3124579..3125337
Genome map
AA seq 252 aa AA seqDB search
MLIIGNHISPYARKVLIALAIKGIAFELDPVVPYFGNDAFTRLSPLRRIPVLVDGDFVLN
DSTVICEYLDEAYPEPPLLPATPRDRAQARWIEEYCDSRMGESIVWKLFFQRVIGPFVWK
QPTDEALVAQALDHDLPAILDWLEGVAPASGFLFGEAPLMADITPACFLRNAAMAGWTVD
AGRWPRSAAWIARVWATPAFAATLPLEHIQRTTPRRDLRAALSAAGVCIASVSHDDRTPR
RGVLTSGAILAP
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcatcggcaaccacatctcgccctatgcccgcaaggtgctgatcgcgctcgcc
atcaagggcatcgccttcgaactcgatcccgtggtgccctacttcggcaacgacgccttc
acgcggctgagcccgctgcgccgcatcccggtgctggtcgatggcgacttcgtgctcaac
gactccaccgtcatctgcgaatacctggacgaggcctaccccgagccgccgctgctgccc
gcaacgccgcgcgaccgggcccaggcgcgctggatcgaggagtactgcgacagccgcatg
ggcgagtccatcgtctggaagctgttcttccagcgcgtcatcggccccttcgtctggaag
cagccgaccgacgaggcgctggtggcccaggccctggaccacgacctgcccgccatcctc
gactggctcgagggcgtggcgcccgccagcggcttcctgttcggcgaggcgcccctgatg
gccgacatcaccccggcctgcttcctgcgcaatgcggccatggccggctggaccgtggac
gccgggcgctggccgcggtcggccgcctggatcgcccgcgtgtgggccacgccggccttc
gccgccacgctgccactcgagcacatccagcgcaccacaccgcgccgcgacctgcgcgct
gccttgagcgcagccggcgtgtgcatcgccagcgtgagccacgacgaccgcaccccgcgg
cgcggcgtgctgaccagcggcgccatcctggcgccttga

DBGET integrated database retrieval system