Campylobacter subantarcticus LMG 24377: CSUB8523_0299 Help Entry CSUB8523_0299     CDS       T03572                                  Symbol acpP1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism csf  Campylobacter subantarcticus LMG 24377 Pathway csf01100   Metabolic pathways csf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:csf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CSUB8523_0299 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CSUB8523_0299 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N PP-binding_2 DUF3219 DUF1493 Motif Other DBs NCBI-ProteinID:  AJC91865 LinkDB All DBs Position 264261..264494 Genome browser AA seq 77 aa AA seqDB search MAIFDDVKKVVVEQLSVDEDAVKMESKIIEDLGADSLDVVELVMALEEKFDVEIPDSDAE KLVKIEDVVNYIENLQK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaatttttgatgatgtaaaaaaagtagttgttgagcaacttagtgttgatgaagat gcagttaaaatggaatctaaaatcattgaagacttaggtgcggattctttagatgttgtt gaattagttatggctttagaagaaaaatttgatgtagaaattccagacagtgatgctgaa aaactagtaaaaatcgaagacgtggttaattatatagaaaatcttcaaaaataa

DBGET integrated database retrieval system