KEGG   Cylindrospermum stagnale: Cylst_1517Help
Entry
Cylst_1517        CDS       T02398                                 

Definition
(GenBank) amino acid adenylation enzyme/thioester reductase family protein
Organism
csg  Cylindrospermum stagnale
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1740776..1746073
Genome map
AA seq 1765 aa AA seqDB search
MNQLINGNDMEEISRNVSTIVELLRYRGLHQPNNQAFTFLQDGETQETILTYLELDRRSR
AVASQLQALGLSGERALLLYPPGLEYLAAFFGCLYAGVVAVPAYPPRNQRNTPRILAILN
DAQAAVILTTTAISSQVQSLFEDKFNINNIHWLTTDNLTAGIEAAWQEPFINQDTLAFLQ
YTSGSTCTPKGVMLSHGNLLHNAAVTRQYMEHSPSSKFVTWLPVYHDMGLIGGVLQPLYS
SFPCIMMPPATFLQRPYRWLEIISRYRGTTSGAPNFAYELCIEKITTEQRATLDLSSWSV
AFNGAEPIRNETLARFADTFAESGFRPEAFYPCYGMAEATLMVSGSVKSALVTTKNFQKN
ALERNHVIDTANEENSVALVGCGRVVPQQQIVIANPETLTSCATNEVGEIWVSGPSIGSG
YWNRPEETEQTFGAYLQDTEAGPFLRTGDLGFLHNDELFITGRVKDLIIIRGRNLYPQDL
ELTAERSHKMLRSGSGAAFAVEVEKEERLVVVQELDFRAKPNIEQVIGAIRQAVAEEHEV
QVYAVVLIKAGTIPKTSSGKIQRRSTKAGFLAGTLDIVGSNILDISQVREAEEILTRAEL
LAIEPSQQQQLLNSYLQKLITRVLRVTPSQLDYQQPLSHLGLDSLKVFELKNQIEVDFQV
GISVADFFDGVSLAELATQILEQVNNNLPCKSLPISKTTTSQDPLSFTQQQLWFINQLRP
GTPAYNIAVAVHLKKQLNVSALVLSLNEIIQRHQILRTSFEIVAGEPVQKVADVVKLTLP
EVDLRHFPDEQQQSELQKLSQQAAKISFDLAQAPLLQVKLLHLPAESILLLTLHHLVADG
WSIKILVEELSAIYQAFADEKPSPLPELPVQYTDFVNWQRNRLQGGVLEKHLAYWKQQLS
GNLPVLQLPTDRPRPPIQTFRGAQQKFVLSKTLTEAIKQISQQESVTLFMTLLAAFQTLL
YRYTGEEDIIIGSPIANRNRVEIEKLIGCFVNTLVLRTNLDGNPSFKELLLRVRQVAIEA
YTHQDLPFEKLVEELKPNRDLSYNPLFQVMFVLQNSVSDGIWKTEEMDTETAKFDAFLSM
VDSEAGLVGTLEYNIDLFNAETIKRMVGHFQTLLEGIVANSNQRISNLPLLTSAERQTLL
VDWNNTKVDFPQAACIHQLFEAQVEKTPDAVAVVFENQKLTYRELNQRSNKLAHYLQSSG
VKPEILVGICMERSVEMVVGILAIMKAGGAYLPLDPTYPQQRLAFMLKDAQVSLLLVQPH
LVDELPPHQAQVISVNSNFAAFSDYSQNNPTTNIQLENIAYVIYTSGSTGKPKGAINTHQ
GLCNRLLWMQDTYQLTPNDRVLQKTPFSFDVSVWEFFWPLFTGATLVLAKPGGHQDASYL
VQLITQEQITTLHFVPSMLQVFLEEIEVDKCHSIKRIICSGEALSLELKEHFFERLQAEL
YNLYGPTEAAIDVTSWCCKPDKKETIVPIGRPIANTQIYVLDRHLQPVPVGIPGELHIGG
VGLARGYLNRPELTHEKFIPHPFNSEKRLYKTGDLARYRVDGSIDFLGRIDHQAKVRGFR
IELGEIEAVLAQHPNVRDTVVIASENRLIAYVVPEQKTASSVNELRHFLKVNLPEYMIPS
AFVFLEALPLNPNGKLDRRALPTPENLRPELTATYQSPQSEIEKTIANMWQDLLHLEKVG
VNDNFFDIGGHSLLVVQLNNKLREILKRDLSVVEIFQNPTIKSLAQHLGKKPDNVPAFKS
MRERTQKQIEAINKQQLLHKQRKKL
NT seq 5298 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaactcatcaatggcaatgatatggaagaaatttcccgtaacgtctctacaatt
gtggaactgttgcgttacagaggtctacaccaacccaataatcaggcttttaccttccta
caggatggagaaactcaagaaacaatattgacatatcttgagttagatcggcgatcgcga
gccgttgcctctcaattgcaagctttaggattgagtggagaacgagccttactcctttat
ccaccaggtttagaatatcttgccgccttttttggttgtctatatgcaggggtggtagca
gttccggcttatcctccacgcaaccaacgcaacacccccagaattttagcaattttgaat
gatgcacaagcggctgtaatccttaccaccacagccatctcgtctcaagtgcaatcctta
tttgaagataaatttaatataaataatattcattggctgactaccgataatctcactgct
gggattgaagcagcttggcaagaaccttttattaatcaagatacactggcatttttacaa
tacacttctggttctacttgcacacctaaaggtgtcatgcttagtcatggcaatttgcta
cacaatgccgccgtgactcgccagtatatggaacattcccccagtagtaaatttgttact
tggcttcctgtttatcatgacatgggactcatcggcggcgtactgcaacctctgtacagc
agttttccttgtatcatgatgccaccagcaacttttctccagcgtccctaccgttggtta
gaaataatttctcgttacagaggaaccaccagtggtgctcctaactttgcctacgaactt
tgtattgaaaaaataacgacagaacaacgcgctaccctggatttaagcagttggagcgta
gcttttaacggcgctgaacctattcgcaacgagactttagcgcgttttgctgatactttt
gctgaatctggttttcgtccagaagctttttatccttgctatgggatggcagaagcaacc
ttgatggtatctggtagcgtcaaatctgctttagtcacaactaaaaatttccaaaaaaat
gctttagaacgcaaccatgtaattgatacagctaacgaagaaaattctgtagccttagtc
ggttgtggccgagttgtaccacaacagcagattgtcattgctaacccggaaaccttaacc
agttgtgcaaccaatgaagttggggaaatttgggtttctgggccgagtattggttctggt
tactggaatcgaccagaggaaacagagcaaaccttcggcgcttacctccaagatacagaa
gcagggccatttttgcggactggagatttaggttttttgcacaacgatgaactcttcatt
actggtcgcgtcaaagatttaatcatcattaggggacgaaatctttacccgcaagaccta
gaactgaccgcagaacggagccataaaatgttgcgttcagggagtggagcggcttttgcg
gtggaagtggaaaaagaagaacgattggtagtggtacaagaactagattttcgagctaaa
cctaatatagagcaagttatcggtgctattcgtcaggctgtagccgaagaacatgaagta
caagtctatgcagtcgttttaatcaaagctggcaccattcccaagacttccagtggtaag
attcagcgccggtctacaaaagcaggatttttagcaggtacattagatatcgttggtagc
aatattctagacatttcccaggtgagagaggctgaagagattctgacacgcgccgaatta
ctagcaatagagccatcacaacaacaacagttattaaattcttacttacaaaaactaata
acacgggtactgagggtaacaccttctcagttagattatcagcaacctttaagtcatttg
ggtttagattccctcaaagttttcgagttaaaaaaccagattgaggttgattttcaagta
gggatatctgtagcagatttttttgatggtgttagtctcgctgagttagcaactcaaatt
ttagagcaagttaataataatcttccttgtaaatctctgcctatctctaagacaaccacc
agccaagatcctctaagttttactcaacaacagttgtggtttatcaatcaactgcgaccg
gggacacctgcatataatattgctgtagctgttcatctaaaaaaacaactgaatgtctct
gcattggtattgagtctcaacgaaattattcaaagacaccaaattttgcgaacaagtttt
gaaatagtcgcaggtgaacctgtccagaaagttgctgatgttgtgaaattaactttacca
gaagttgatttacggcattttcccgacgaacagcagcagagcgaattgcaaaaattatct
cagcaagcagctaaaatatcctttgatttagcgcaagcaccattattgcaggtgaaactg
ctgcatttgccagcagaatcaatattacttttgacactgcatcatctggtggctgatggg
tggtcaatcaagattttagttgaagaattatcagcaatttatcaagctttcgctgatgaa
aagccgtcaccattaccagaacttcctgtacaatacactgactttgtaaattggcaacga
aaccgtttacaaggtggagttttagaaaagcatttagcttattggaaacaacaattaagt
ggaaatctcccagtactgcaattacctacagaccgtccccgaccgccaatacagactttc
cggggagcgcagcaaaagtttgttttatctaaaaccttaactgaagcaattaaacagatc
agccaacaggaaagcgtgactttattcatgactttgttagcggcgtttcagactttgctt
taccgctacacaggtgaggaagatattattatcggttcaccaattgctaaccgcaatcgt
gttgaaatagaaaaactaatcggttgttttgtcaatactttagtattgcgtaccaattta
gatggaaatcctagctttaaagaattgctcttgagagtgcgtcaggtggcaattgaagcc
tatactcaccaagatttgccatttgagaagctggttgaagagttaaaaccaaaccgggat
ttaagctataacccattattccaggtaatgtttgttctccaaaattctgtatcagatgga
atctggaaaactgaggagatggatactgaaacagccaagtttgatgcctttttatcgatg
gtggatagtgaagcgggattggtcgggacgctggaatacaacatcgatttatttaatgca
gaaactatcaaacgaatggtaggacatttccaaactttgctagagggtatcgttgctaat
tctaaccagcgtatttctaacttaccactattgacctctgctgaacggcagacactgctg
gtagactggaacaacactaaagttgatttcccccaagcagcttgcatccatcaattattt
gaggcacaggtagaaaaaacaccggatgctgtagcagtggtatttgagaatcaaaaactt
acttaccgcgagttaaatcaacgctccaataaactcgctcactacctacaaagttcaggt
gtgaaaccagagatattggttggtatttgtatggagcgttctgtagaaatggtagttggg
atattagcaatcatgaaagccggtggtgcgtatttaccgctagatcctacctatcctcaa
cagcgtttagcgttcatgttaaaagatgctcaagtatctttgttgctggtgcaaccgcat
ctagttgatgaattaccaccacatcaagcccaagttataagtgtaaatagcaattttgca
gcattttctgattacagccaaaacaacccgactactaacatccagttagaaaacattgcc
tatgtaatttatacttctggttccacaggcaaacccaaaggagctattaacactcatcaa
ggcttatgcaaccgcttactgtggatgcaagacacttatcaactaacacccaatgataga
gttttgcaaaaaacaccttttagttttgatgtgtctgtttgggaatttttctggccttta
tttactggtgctactctagttttagccaaacctggtggtcatcaagatgcaagctatcta
gtgcaacttattacccaagagcagattacaacattgcactttgtcccctcaatgctgcaa
gtctttttagaggaaatcgaggttgataaatgccatagtatcaaacggataatttgtagt
ggtgaggcactatccttagagctaaaagaacacttttttgagcggttgcaggcagaacta
tataatctatacgggccaacagaagcagctattgatgtcacttcatggtgctgtaaaccg
gataaaaaagaaacaattgttcctatcggtcgcccaattgccaatactcagatatatgta
ttagataggcatttacaacctgttcctgttggtattccgggtgaattgcatatcggtggc
gttggtttggcacgaggatatttaaatagacctgagttgactcacgaaaaatttatccct
catccatttaactcagaaaaacgtctttacaaaacaggtgatttagcacgttatcgagtt
gatggaagcattgattttttaggcagaattgaccatcaagcaaaagttcgcggcttccgt
atagaattgggagaaattgaggcagttttagcacaacatccaaatgtgcgagacacagta
gtcattgctagtgaaaatcgtcttattgcttatgtagtgcctgagcaaaagacagcatct
tctgtgaatgaattacgacattttctgaaggtaaatctgcctgaatatatgattccttct
gcctttgtatttttagaagcattacctctaaaccccaatggcaaattagaccgtcgtgct
ttacctacaccagaaaatttgcgtccagaattaacagctacttatcagtctcctcaatct
gagatagagaaaacaatagctaatatgtggcaagatctgctgcatttagaaaaagtaggt
gtcaatgataatttctttgacattggtggacattctttgctagtagtgcagctaaataac
aaactacgggagatattaaaacgagatttatcagttgtagaaatttttcaaaaccccact
attaagtcattggctcaacatttaggcaaaaaaccagataatgttcctgcttttaaatca
atgcgtgaaaggactcagaagcaaatagaggctatcaataaacaacaattgttgcataag
caaagaaaaaaattataa

DBGET integrated database retrieval system