KEGG   Cronobacter sakazakii ATCC 29544: CSK29544_00667Help
Entry
CSK29544_00667    CDS       T03903                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
csj  Cronobacter sakazakii ATCC 29544
Brite
Translation factors [BR:csj03012]
 Eukaryotic Type
  Elongation factors
   CSK29544_00667
 Prokaryotic Type
   CSK29544_00667
Mitochondrial biogenesis [BR:csj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CSK29544_00667
Exosome [BR:csj04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CSK29544_00667
  Exosomal proteins of breast cancer cells
   CSK29544_00667
  Exosomal proteins of colorectal cancer cells
   CSK29544_00667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(691092..692276)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGHLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKDTAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgccatcactaccgttctggcgaaaacctac
ggtggttctgctcgtgcattcgaccagatcgataacgcgccggaagaaaaagctcgtggt
atcaccatcaacacctctcacgttgaatatgacaccccgactcgccactacgcgcacgtt
gactgcccgggccacgccgactacgtgaaaaacatgatcaccggtgctgctcagatggac
ggcgctatcctggttgttgctgcgactgacggcccgatgccgcagacccgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgagatggaagtgcgtgagctgctgtctcag
tacgacttcccgggcgacgacaccccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgacgctgagtgggaagcgaaaatcatcgagctggcaggtcacctggattcctacatc
ccggaaccggagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaggttggt
gaagaagttgaaatcgtgggcatcaaagacaccgcgaaatccacctgtaccggcgttgaa
atgttccgcaaactgctggacgaaggccgtgcgggcgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggctccatcaag
ccgcacaccaagttcgaatctgaagtgtacattctgtccaaagatgaaggcggccgtcac
actccgttcttcaaaggctaccgtccgcagttctacttccgtacaactgacgtgactggc
accatcgaactgccggaaggcgtggagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcgatggacgacggtctgcgtttcgcaatccgcgaaggc
ggccgtaccgttggcgcgggcgtggttgctaaagttctcggctaa

DBGET integrated database retrieval system