KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_14569Help
Entry
COCSUDRAFT_14569  CDS       T02914                                 

Definition
(RefSeq) SET domain-containing protein
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
csl  Coccomyxa subellipsoidea
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:csl00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    COCSUDRAFT_14569
Enzymes [BR:csl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     COCSUDRAFT_14569
Chromosome [BR:csl03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     COCSUDRAFT_14569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 295 aa AA seqDB search
ARRARRRPQVWQLIRENIYTHRAPKVQDEDDVMLCHCRLPNDGGPGCGPDCLNRMLNMEC
VPGYCPCGERCSNQQFSKRQYAKLEKRRAGAKGFGLFATQDLVAGQFIVEYIGEVLEEEE
YLRRKDYYQESGQRHYYFMNIGNGEVIDAARKGALGRFINHSCNPNCETQKWVVRGELAI
GLYALKDIPAGVELTFDYNFERYGDKPMRCLCEAKVCRGFIGGTGEAVAQEQDLEDPADA
SEDPEPIMVLENEAAEPALVAILESEVGLASEFWDASVWQRCVPSAVPSLCYCGP
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gccaggagggcacgaaggaggccacaggtgtggcagctcatcagggagaacatctacacg
caccgtgcccccaaggtgcaggatgaggacgatgtcatgctgtgccactgccggctgccc
aatgatggaggtcctggctgcgggccagactgcctcaatcgcatgctcaacatggagtgt
gtgccgggctactgtccctgtggagagcgatgcagcaaccagcagttctcaaagcggcaa
tatgcaaagctggagaagcggcgagccggagccaagggttttggcctctttgccacacag
gacctggtggccggccagttcatagtggagtacattggagaggtgctagaggaggaggag
tacttgcggcggaaggattactaccaggaatccggtcagcgccactactacttcatgaat
atcggaaatggcgaagtcatcgatgccgcacgcaagggagcgctggggcggttcatcaac
cattcctgcaacccaaactgcgagacgcagaagtgggtggtgcgcggtgagcttgccatc
ggcctctacgcgctcaaggacatccctgccggcgtcgagctcacctttgactacaacttt
gagcgctacggcgacaagccgatgcggtgcctgtgcgaggccaaggtatgccgcgggttc
atcggcggcacgggcgaggcggtggcgcaggagcaggacttggaggatccggccgacgcc
agcgaggaccctgagcccatcatggtgctggagaatgaagctgccgagcctgcgctggtc
gccatcctggagtccgaggtcgggctggcctctgagttttgggacgcctccgtctggcag
cggtgcgtgccctctgctgtgccttctttgtgctactgtggaccctaa

DBGET integrated database retrieval system