KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_31327Help
Entry
COCSUDRAFT_31327  CDS       T02914                                 

Definition
(RefSeq) glutathione S-transferase
Organism
csl  Coccomyxa subellipsoidea
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 215 aa AA seqDB search
MAAQRTIWWGSGSAPAWRVLIGLKEKGLEYDSKLIEFSKKEHKSEDILRLNPRGQVPTFL
DDGVVVNESLAALLYLQDKYPEPSLLPATIEGRALVYQRFQEAANFHDKVSQVIRFKWTN
ADEALPQDKLDALQAELELWESYLSEDSFIAGPDFTLADISFGPFLLVFKRFGGTLKDFP
KLNKYAEKIEARPSFEDSYPPHWKETPGKDWLDSL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcagcggacaatctggtggggcagtggctctgctccagcatggagggtgctc
atcggcctcaaagagaaggggctggagtacgacagcaagctcatcgaattttccaaaaag
gaacacaagtcggaggatatcctgaggctgaaccccaggggccaagtgccaactttcctg
gacgatggcgtcgttgtgaacgagtccctggccgccctgctgtatctccaggacaagtac
cccgagccatccctgctgcctgccaccatcgagggccgtgccctggtgtaccagcgtttc
caggaggctgcaaacttccacgacaaggtcagccaggtcatccgcttcaagtggacgaat
gctgatgaagcgttgcctcaggacaagctggacgcgctacaggcagagctggagctttgg
gagagctacctgagcgaagacagcttcattgcaggccctgacttcacactggcagatatc
tcattcggaccgttcttgctggtgttcaagcgctttggaggcaccctgaaggacttccca
aagctcaacaagtacgctgagaagatcgaggctcgcccctcctttgaagacagctacccg
ccgcactggaaggagactcctggcaaggactggctcgacagcctgtga

DBGET integrated database retrieval system