KEGG   Cyanobacterium stanieri: Cyast_0249Help
Entry
Cyast_0249        CDS       T02377                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
csn  Cyanobacterium stanieri
Brite
Enzymes [BR:csn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cyast_0249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(265826..266425)
Genome map
AA seq 199 aa AA seqDB search
MAYELAPLPYDYSALEPCISKSTLEFHHDKHHAAYVSKYNDAVKGTDLEAKPIEEVIKSI
ANDASKAGVFNNAAQAWNHSFYWQCMKPNGGGTPTGELAAKIDADFGSFDKFVEEFKNAG
ATQFGSGWAWLVLDNGTLKVTKTGNAGNPITAGQTPLLTMDVWEHAYYLDYQNKRPAYID
DFLGKLVNWDFVAQNLANA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaattagcacctcttccttacgattacagtgccctagagccctgtatctcc
aaaagtaccctagaatttcaccatgacaaacatcacgcagcttatgtaagtaagtacaac
gatgcagtcaaaggtaccgatttagaagcaaaacctattgaagaagtaatcaaaagcatt
gccaacgacgccagtaaagcaggggtatttaacaatgccgctcaagcatggaatcacagc
ttctactggcaatgtatgaagcccaacggtggtggtactcccactggagaattagccgct
aaaattgacgccgatttcggtagtttcgacaaatttgtagaagaatttaaaaacgcaggt
gcaacccaattcggtagcggttgggcttggttagtattagacaacggcaccttaaaagta
accaaaactggtaatgccggtaatcctatcaccgcaggacaaactcccctcctcaccatg
gatgtatgggaacacgcttactacttagattatcaaaacaagcgtcctgcgtatatcgat
gatttcttaggtaaattagtaaactgggattttgttgctcaaaacctagcaaatgcctaa

DBGET integrated database retrieval system