KEGG   Cyanobacterium stanieri: Cyast_2422Help
Entry
Cyast_2422        CDS       T02377                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
csn  Cyanobacterium stanieri
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:csn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cyast_2422
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyast_2422
   00680 Methane metabolism
    Cyast_2422
Enzymes [BR:csn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cyast_2422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2660469..2663531
Genome map
AA seq 1020 aa AA seqDB search
MTFTKTSHKEELSIYSNSELLLRHRLKLVENLWELVLRNECGQHLVDLLEQLKSACSPEG
QTSETPKQSVSKWIEQLELDDAIKAVRALALYFQLINIVEQHYEQRNQKIIRSTTTEDQV
NGSQVDSIIDKLIEGETQKVVVDSGDKDYSYFEQKPNPASGGTFHWLFPHLQQLNMPPQK
IQDLLDELDIRLVFTAHPTEIVRHTIRKKQRRISQILERLDVAEESCRAMGLTNSYEAEH
FRNRLMDEIQLWWRTDELHQFKPTVLDEVDYALHYFQEVLFDSLPHLSKRLQQALHNTFP
KLKPPSHKFCYFGSWVGGDRDGNPFVTPEVTWSTACYQRNLVIEKYLESVAKLNDVLSLS
LHWCNVLPELLDSLEKDRIKMPEVYDKLYVRYRQEPYRLKLAFIEKKLENTKARNEALSN
PETRKSIKLATKDDNLYPSASDFLEDLNLLKLNLEQTGLNCQELDHLIFQVDIYGFHLAE
LDFRQDSSRHSDALNEIAEYLGVLDKPYNELSEEEKTAWLVRELKTRRPLVPNPIPFSET
TAETIETFKVLRALQVEFGIEICNTYIISMTNYVSDVLEVLLLAKEAGLYDPVIGASSIR
IVPLFETVEDLKRSHSVMKELFDLPLYRACLAGGYDSSGDSQSNVTMPKLTPHNLQEIML
GYSDSNKDSGFMSSNWEIHKAQKVLAKLGNAYGVKIKIFHGRGGSVGRGGGPAYAAILAQ
PTSTINGRIKITEQGEVLASKYSLPELALYNLETISTAVIQASLLGSGFDDIEPWNEIME
EIAIASRKAYRSLIYEEPDFIDFFLSVTPIEEISKLQISSRPARRKKGKKDISSLRAIPW
VFSWTQSRFLLPAWYGVGTALQEFLAKEPEENLKLLRYFYLKWPFFKMVISKVEMTLSKV
DLQMASHYVEELAEDEDKERFHKLFSQIAKEYYLSREMVLKINQQERLLDTDPELQRSVQ
LRNGSIVPLGFLQVSLLKRLREYANQDKAGLIHFRYSKDELLRGALLTINGIAAGMRNTG
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgacttttactaaaactagccataaagaagaactaagcatttattctaattcagagtta
ttattgcgtcatcgacttaagttggtcgagaatttgtgggagttagttttgagaaatgaa
tgcggacagcatttggtagatttattagaacagttaaaatctgcttgttctcccgaaggt
caaacttcggaaactcctaaacaatctgtcagtaaatggattgagcaattagaattagat
gatgccatcaaggctgtacgggctttagcactttatttccaattaattaatattgtcgag
caacattacgagcagagaaaccaaaaaattatccgtagtaccaccaccgaagatcaggta
aatggttctcaagtagatagtattattgataaattaattgaaggggaaactcaaaaggta
gttgttgattctggggacaaggattatagttattttgagcaaaaacccaaccccgctagt
gggggaacttttcattggttattcccccatctccaacagttaaatatgccccctcaaaaa
attcaagatttgttggatgagttggatattcgtttggtatttaccgcccaccccacagaa
attgtgcgtcataccattcgtaaaaaacaaagacgtatttcccaaattttagagcgtttg
gatgtggcggaagaatcttgtcgcgccatgggcttaaccaattcctatgaagctgaacat
tttcgcaaccgtttgatggatgagattcaattatggtggcgcaccgatgagttacaccag
tttaagcccacggtattggatgaggtggattatgcccttcactatttccaagaggtgtta
tttgatagtttgccccatctttctaagcgtttacaacaggctttgcataatacttttcct
aagttaaaacctcctagtcataagttttgttattttggttcttgggtagggggcgatcgc
gacggtaatccttttgtaacccccgaagttacatggtcaacagcttgttatcaacgtaac
ctcgtcatcgagaaatatttggaatccgtggcgaaattaaacgacgtactcagcttatcc
ctccattggtgtaatgtcttaccagagttgttagactccttggaaaaagatcgtatcaaa
atgccagaggtatatgataaattatacgtccgttatcgccaagaaccctatcgtctcaaa
ttagcttttatcgagaaaaaattagaaaataccaaagcaagaaatgaggcactttctaat
cccgaaacccgtaaatccatcaaattagccaccaaggatgataatttatatcctagtgct
agtgattttcttgaggatttaaacctactcaagctcaaccttgaacaaacgggcttaaac
tgtcaggaattagatcatctcatcttccaagtagatatttatggcttccaccttgccgag
ttagattttcgtcaagattcttctcgccattccgacgctttgaatgaaattgccgaatat
ttgggggttttagataaaccctataacgaattgagcgaggaagaaaaaaccgcatggcta
gtgagagaattaaaaacccgtcgccccctcgtgcctaatcccattcctttctcggaaacc
accgccgaaaccattgaaacttttaaggtgttaagggcgctgcaggtagaatttggcatc
gaaatttgtaatacctacatcatcagtatgaccaactatgtcagtgatgttttggaggtg
ttgttgttggcaaaagaagcagggttatatgaccctgtgattggggccagtagcattcgt
atagtgcctctatttgagacggtggaggatttaaagagatcccactcggtgatgaaagaa
ttgtttgatttacccctttatcgtgcttgtttggcagggggttatgattcttcgggtgat
agtcaatcgaatgtgacaatgccaaaattaactccccataatcttcaggaaatcatgctc
ggttattctgatagtaataaggattctgggtttatgagtagtaactgggaaattcacaaa
gcccaaaaagtcttggcaaaattgggtaatgcctatggggtgaaaatcaaaattttccac
ggtagaggtggctctgtgggtaggggaggaggccctgcctatgcggcgattttggctcaa
ccaacttccaccatcaacgggcgtatcaaaattactgaacaaggggaggtgttagcttct
aagtattccttaccagagttggctttatataatcttgaaaccatcagcaccgctgtaatt
caggctagtttattgggtagcgggtttgatgatattgagccttggaatgagattatggaa
gaaattgcgatcgcctctaggaaagcgtatcgatccttaatttacgaagaacctgatttt
atcgacttcttcctttccgtcacccccatcgaggaaatcagtaaactacaaataagctct
cgccctgcccgtcgtaaaaaaggtaaaaaggatattagctccctccgtgccattccttgg
gtgtttagttggactcaaagccgtttcttgctccccgcttggtatggggtcggtaccgcc
ctacaggagtttttagccaaagagccagaggagaatttgaaattattacgctatttttat
ctaaaatggcctttcttcaaaatggtgatttctaaagtggaaatgaccctttctaaggtt
gatttacaaatggcaagtcattatgtagaagaattggcagaagacgaagataaagagcga
ttccataagctattttctcaaattgccaaagaatactatctgagtcgggaaatggtacta
aaaatcaatcaacaagaacgattattagatactgaccccgaattgcagcgctcggtacag
ttgcgtaatggttctattgtaccccttggctttttacaagtatctttgttaaaacgtctg
agggaatacgcaaatcaagacaaagcaggattaattcacttccgttatagtaaagatgaa
ctattaagaggggctttattgaccattaatggtatcgccgcagggatgcgcaatacaggt
tga

DBGET integrated database retrieval system