KEGG   Clostridium scatologenes: CSCA_2674Help
Entry
CSCA_2674         CDS       T03803                                 

Definition
(GenBank) manganese and iron superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
csq  Clostridium scatologenes
Brite
Enzymes [BR:csq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CSCA_2674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2955608..2956264
Genome map
AA seq 218 aa AA seqDB search
MFKLEPMNFNFSTVKGITEDQLMQHYKLYSGYVKKLNELWNFPVDARSYGEGNSTYSNMR
SLKLGETYALDGITLHQLYFENICNSFKKPYGEILNLIMRDFKSFENFKEYLTNVGLSMR
GWAILIIDPIDNKLHIIGSDAHDVGALWNCYPLLVMDVYEHAYFIDFQTDRKKYIEVFMK
NINWKIVNERLEKYYSIKSTLSKLRYFENNPICPRWYI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaaattagagcctatgaattttaatttttctactgtaaaaggtattactgaagat
caattaatgcagcattataaattatattctggatatgtaaagaaattaaacgaactctgg
aactttcctgtagatgctagaagctatggtgaaggtaattcaacttatagcaatatgaga
agtcttaagttaggagaaacttatgctttagatggaattaccctacaccaattatatttt
gaaaatatatgcaatagttttaaaaaaccttatggtgaaatacttaatttaataatgaga
gattttaaaagctttgaaaatttcaaagagtatttaacaaatgtaggactctccatgaga
ggatgggctattttaatcatagatcctatagataataaactccatatcataggttctgat
gctcatgatgttggagccttatggaactgttatcctttacttgttatggatgtatatgaa
catgcctatttcatagattttcagacagatagaaaaaaatacattgaagtatttatgaaa
aatataaactggaaaatagtaaatgaacgacttgaaaaatactattcaattaaatctaca
ttgagcaagcttaggtactttgagaataatcctatatgccctagatggtacatttaa

DBGET integrated database retrieval system