KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c55060Help
Entry
Cspa_c55060       CDS       T02467                                 

Gene name
pfkA2
Definition
(GenBank) 6-phosphofructokinase PfkA
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:csr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cspa_c55060 (pfkA2)
   01230 Biosynthesis of amino acids
    Cspa_c55060 (pfkA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cspa_c55060 (pfkA2)
   00030 Pentose phosphate pathway
    Cspa_c55060 (pfkA2)
   00051 Fructose and mannose metabolism
    Cspa_c55060 (pfkA2)
   00052 Galactose metabolism
    Cspa_c55060 (pfkA2)
  Energy metabolism
   00680 Methane metabolism
    Cspa_c55060 (pfkA2)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cspa_c55060 (pfkA2)
Enzymes [BR:csr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cspa_c55060 (pfkA2)
Protein phosphatases and associated proteins [BR:csr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cspa_c55060 (pfkA2)
Messenger RNA biogenesis [BR:csr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Cspa_c55060 (pfkA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6157247..6158203)
Genome map
AA seq 318 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAIRAVVRTALHNGIEVMGVQRGYSGLINGELFSMDRNSVSDI
IQRGGTVLRTARCPEFKNEEVRKKAAKILQAYGVEALVVIGGDGSFMGAKLLSKLGIKTI
GLPGTIDNDLAYTDFTLGFDTALNTVVDAINKIRDTSTSHERVSIVEVMGRDCGDLSLYA
GICGGAEAIIIPEIDFDKDALCRTILEGKNRGKMHNLVILAEGIGGAFELAKEVEEVTGI
ETRATILGHIQRGGSPTATDRVLASRMGARAIEVLLEGKTSRVIGIKDNKIIDQDIDEAL
DMESKFDKELYDIAQVLS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagctgtgttaacaagtggtggagatgcacctggtatgaatgctgcaatt
agagctgttgtaagaactgcccttcataacggtatagaagttatgggagttcaaagagga
tatagtggactaattaatggtgaattatttagtatggatagaaattctgtatctgatata
attcaaagaggtggaacagtactaagaactgcaagatgtccagaatttaaaaatgaagaa
gttagaaaaaaagctgctaaaatattgcaagcatatggtgttgaagcgttggtagttatc
ggcggagatggatcattcatgggtgcaaaattattatcaaagcttggaattaaaacaata
ggtttaccaggaacaatagataatgatttagcttacacagattttactttagggtttgat
acagctttaaatactgtagtagatgctataaataaaatcagagacacttcaacttctcat
gaaagagtttctattgtagaagttatggggagagactgtggcgatttatctttatatgca
ggtatttgtggtggtgcagaagcaatcataattcctgagatagattttgataaggatgca
ctttgcagaactatcttagaaggaaaaaatagaggaaaaatgcataatttagtaatcctt
gcagaaggaattggtggagcatttgaacttgcaaaagaagttgaagaagtaacaggaata
gaaacaagagcaacaatcttaggtcatattcaaagaggaggaagtcctactgctactgat
agagtcttagcttcaagaatgggagcaagagctatagaagtattattagaaggaaaaact
tcaagagtaattggaattaaagataataaaataatagaccaagatatagatgaagctcta
gatatggaaagtaaatttgataaagagctatatgatatagctcaagtattatcataa

DBGET integrated database retrieval system