KEGG   Candidatus Caldiarchaeum subterraneum: CSUB_C0311Help
Entry
CSUB_C0311        CDS       T02904                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
csu  Candidatus Caldiarchaeum subterraneum
Brite
Enzymes [BR:csu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CSUB_C0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(304693..305304)
Genome map
AA seq 203 aa AA seqDB search
MTMKKYSLPPLPYAYNALEPVISAEIMTLHHTKHHQAYVNGANAALERLEKQRKGENPEN
IRGILRDLSFNLSGHKLHSVFWPNMAPPGKGGGTPGGAIADQINKDFGSFENFKKQFSDA
AKNVEAVGWAILTYDPESETLVIYQVEKQNFMHPPDLPLLLTLDVWEHAYYLQYKNDRAA
YVDKWWEVVNWDDVEKRFSKLKV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgacgatgaaaaaatatagcttgccacctcttccatatgcatacaacgcgctggagccc
gtgatatccgccgagatcatgacgcttcaccacaccaagcatcatcaagcatatgtaaac
ggcgccaacgcggctctcgagaggctggagaaacagcggaagggtgagaaccctgaaaac
atccgcggcatactgcgggacctcagcttcaacctcagcggacacaagctccactcagtc
ttctggccaaacatggcgccgccgggaaaaggcggaggaacaccgggaggagcaatagcc
gaccagataaacaaggactttggcagcttcgagaacttcaagaaacaattcagcgacgca
gccaaaaacgtcgaagccgtgggctgggccatactcacatacgacccagaatccgagaca
cttgtcatctaccaggtggagaaacagaacttcatgcatccacccgacctcccactcctg
ctcaccctcgacgtatgggaacacgcctactacctacaatacaaaaacgaccgcgccgca
tacgtagacaagtggtgggaagtcgtcaactgggacgacgtcgaaaaaagattctctaaa
ctaaaggtctaa

DBGET integrated database retrieval system