KEGG   Cucumis sativus (cucumber): 101215511Help
Entry
101215511         CDS       T02486                                 

Definition
(RefSeq) hexokinase-3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00010  Glycolysis / Gluconeogenesis
csv00051  Fructose and mannose metabolism
csv00052  Galactose metabolism
csv00500  Starch and sucrose metabolism
csv00520  Amino sugar and nucleotide sugar metabolism
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
csv01200  Carbon metabolism
Module
csv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
csv_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101215511
   00051 Fructose and mannose metabolism
    101215511
   00052 Galactose metabolism
    101215511
   00500 Starch and sucrose metabolism
    101215511
   00520 Amino sugar and nucleotide sugar metabolism
    101215511
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101215511
Enzymes [BR:csv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101215511
Membrane trafficking [BR:csv04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101215511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 101215511
NCBI-ProteinID: XP_004139044
UniProt: A0A0A0LZT2
LinkDB All DBs
Position
1
AA seq 507 aa AA seqDB search
MGGKLMFGVTVGVAVAACVVATVLVSRRVKSRSKWKRVVGVLEELEATCDTPLRRLRQVV
DAMAVEMHAGLASEGGSKLKMLLTYVDNLPNGSEIGTFYALDLGGTNFRVLRVPLGGQRS
LTLKHDVERQPIPQNLMTGTREGLFDFIASSLKEFVEKTDDPDELAPRRKELGFTFSFPV
KQTSASSGVLIKWTKGFSIEDMVGRDAAESLQQAIDRIGLGLRVSVLINDTVGTLAVGHY
QDPDTVAAVIIGTGSNACYVERTDAIIKCQGLCTTSGSMVINMEWGNFWSSHLPRTTYDI
DLDADSPNPSDQGFEKMISGMYLGDIVRRVILRISQESDVFGPASTRLSMPFKLRTPMMA
AMHEDSSPELTEVARIFEDILEITDIPLKVRKLVVKICDIVTRRAARLAAAGIVGILKKI
GRDGTSGIAGGRSRADVKPRRTVVAIEGGLYTSYTIFREYLHEALVEILGEEIAPHVILK
PTEDGSGIGAALLAASYSSYDTDANLL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgggggggaagttgatgtttggtgttacggtcggcgtagcggtggcggcatgtgtggtg
gccacggtcctagtcagtcggagagttaagagccggagtaagtggaagagagtggtcggg
gttttggaagagcttgaagccacttgtgatactcctctgaggagattgagacaggtggtt
gatgctatggctgtggaaatgcatgctgggttggcttctgaaggtggttccaagcttaaa
atgctactcacatatgttgataatctgcctaatgggagcgagataggaacattttatgct
ctggatcttgggggtactaattttagggttttgagagttcctctcggtggccagaggtct
cttactttgaagcatgatgtggagcggcagccaattccccaaaatttaatgacgggcact
cgcgagggtctatttgattttattgcttcatcactgaaggagtttgtagagaaaacagat
gatcctgatgagttggcccctaggagaaaggaacttggatttacattttcctttcccgtt
aaacaaacatctgcttcatcaggcgtgttgattaaatggactaaaggattttccattgaa
gacatggttggaagagatgctgcagaatctttacaacaagccattgataggattggacta
ggtttgcgggtatcagtactgattaatgacactgtgggaacattagctgttggacattat
caagatcctgacactgttgctgcagttataattgggactgggtccaatgcttgctatgtc
gaacgtacagatgctattatcaaatgccaggggctttgtacgacatctgggagcatggtt
attaacatggaatggggaaacttttggtcttctcatttaccaagaactacttatgatatt
gatttggatgctgatagccccaatcccagtgatcagggctttgagaagatgatatcgggt
atgtatcttggtgatatcgtgaggagagtgattctgaggatttcacaagaatctgatgtt
tttggccctgcttctactcgattatcaatgcccttcaaattgagaacaccaatgatggct
gcgatgcacgaggacagctccccggaattgacagaagtagcacggatttttgaagacatc
ttggagatcactgatatacccttaaaggttcgaaagcttgtagtgaaaatatgcgatatt
gtgacacgtagagctgctcgcttggcagctgctggtattgtgggcatcctgaagaagata
gggcgggacgggacaagtggaattgctggtggaagaagtagagccgacgtcaaacctaga
cgaacagttgttgcaattgagggaggtttatatacaagctatacaatcttccgagagtat
ctacatgaagctttggttgaaatactgggagaggagattgccccgcatgttattttgaag
ccaacagaagatggttcgggtattggagcagcactactggcagcttcttattcatcgtac
gatacggacgcaaacttgctataa

DBGET integrated database retrieval system