KEGG   Cucumis sativus (cucumber): 101218300Help
Entry
101218300         CDS       T02486                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101218300
   00051 Fructose and mannose metabolism
    101218300
   00052 Galactose metabolism
    101218300
   00500 Starch and sucrose metabolism
    101218300
   00520 Amino sugar and nucleotide sugar metabolism
    101218300
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101218300
Enzymes [BR:csv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101218300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALVVRHRMRNSGKWARAMAILREFEDKCGTPIGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKENR
VVKQEFEEVSIPPHLMVGSSEALFDFIAQALAKFVAEEGEGFHPAPGRQRELGFTFSFPV
RQTSISSGTLIKWTKGFSIEDTVGEDVVGELTKAMEKLKLDMRVTALVNDTIGTLAGGRY
HDNDVIAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLSLTEYDH
ALDAESLNPGEQIFEKLISGMYLGEIVRKVLVKMAEEAAIFGDTVPPKLKIPFILRTPHT
SAMHHDTSPDLKVVASKLKDVLEISNTSLKTRKIIVELCDVVATRGARLSAAGILGILKK
LGRDTVRVGEKQKSVVALDGGLYEHYTKFRTTMENTLKELLGDEVAANVFVEHSNDGSGI
GAALLAASHSQYLEVEEP
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggttgcggtgggagcggcggtggtgtgtgcggctgcggtttgtgctgcagcg
gcgttagtggtgcggcatcgaatgagaaactccgggaagtgggcgcgagcaatggccatt
ttgagagagttcgaggacaaatgtggaaccccaattggaaaactcaggcaggtggccgac
gccatgaccgtcgagatgcacgccggccttgcatccgaaggcggtagcaagctcaagatg
ctgatcagctacgtcgataatctcccgaccggagatgaaaaagggctcttctatgcattg
gatctcggcggtacaaattttcgagtgttgcgtgtgcagttgggggggaaggagaaccgg
gttgtcaagcaagaatttgaggaggtttcaatacctccacacttgatggttgggtcatca
gaagctctatttgattttatagctcaagcacttgcaaagtttgttgctgaagaaggtgaa
ggctttcacccagcaccgggtaggcaaagggaattgggttttaccttctccttccctgtt
aggcaaacatcaatatcatcagggacacttattaaatggacgaaaggcttcagcattgaa
gacacggttggagaagatgtggtcggtgaattaaccaaagccatggaaaaactgaaactc
gacatgcgtgtaacagcgttggtaaacgatacgattggaacattagcaggaggtagatac
catgataacgatgtaattgctgctgtgattttaggcaccggaacaaatgcagcttatgta
gagcgtgcccatgcaattcccaagtggcacggtctacttcctaaatcaggagaaatggta
attaacatggaatggggtaacttccggtcctcgcatctgtcgcttacagaatatgatcat
gcattggatgctgagagtttaaaccctggagaacagatcttcgagaagttgatttctggt
atgtacttgggagaaattgtacgtaaagtattggtcaagatggctgaagaagcggctatc
tttggtgacactgttccacccaaactgaaaattccatttatattgaggactcctcacacg
tctgcgatgcatcacgacacgtcacccgacctcaaagttgttgcaagcaaactgaaggat
gtcttggagatatccaatacctccttgaaaacaagaaaaatcatagtggagctctgtgac
gtagttgcaacacggggcgcccgactctctgctgctggtatcttaggcatcctgaaaaaa
ctgggaagagacaccgtccgggttggggagaagcagaagtctgttgtagcattggatgga
gggttgtatgagcactacacaaaattcagaactaccatggaaaacacactgaaggagcta
cttggagatgaggtagctgcaaacgtcttcgtcgagcattcaaacgatggttctggcatc
ggagctgcactacttgcagcctctcactctcaatatcttgaggtagaggagccctaa

DBGET integrated database retrieval system