KEGG   Corynebacterium singulare: CSING_03575Help
Entry
CSING_03575       CDS       T03630                                 

Gene name
gabT1
Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
csx  Corynebacterium singulare
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CSING_03575 (gabT1)
   00650 Butanoate metabolism
    CSING_03575 (gabT1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CSING_03575 (gabT1)
   00280 Valine, leucine and isoleucine degradation
    CSING_03575 (gabT1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CSING_03575 (gabT1)
Enzymes [BR:csx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CSING_03575 (gabT1)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CSING_03575 (gabT1)
Amino acid related enzymes [BR:csx01007]
 Aminotransferase (transaminase)
  Class III
   CSING_03575 (gabT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(732150..733475)
Genome map
AA seq 441 aa AA seqDB search
MQDLTHRLPQERNVTTAIPGPRSQELNATRESEIAAGVIPGYPSYITDGDGGVLLDVDGN
TLIDFASGIAVTSVGASNQRVAKAVAEAASHLTHTCFLNAPYEGFIKVAQKLNELTPGTH
DKKTVLFSTGAEAVENAVKIARNYTGKNRVVVFDGAFHGRTNLTMTMTAKNKPYKSGFGT
LAADIYRAPMSYPLRDGLDGKQAAERTLRYIEQYVGTEELAAVIIEPVQGEGGFVEPAKG
FLPALQEWCTDNGVVFVADEIQAGICRTGSWFASEDEGIIPDLITTAKGVGGGMPLSAVT
GRAEIMDSPGPGSLGGTYAGNPVACAASLAAFEEMEELDLNSRAREIEAIIREELEPLLE
LTTVAEVRGRGAMIALELVDDNNQPNADLTAKVAKTCREQGVIVLTCGLDGNVIRLLPPL
VINESTLRDGLGVLADAIRAN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatctcacccaccgcctccctcaggagcggaacgtcaccactgcaattcctggc
ccgcgcagccaagagctcaacgccacccgcgaatccgaaatcgctgccggcgtcatcccg
ggctacccgtcctacatcaccgatggtgacggcggcgttcttctcgatgtcgacggcaac
accctcatcgacttcgcatctggcattgccgtcaccagcgtgggtgcgtccaaccagcgc
gtagccaaggccgtggccgaggccgccagccacctcacccacacctgcttcctcaatgca
ccgtacgaaggcttcattaaggtggcacagaagctcaacgagctgaccccgggcacccac
gacaagaagaccgtactcttctccaccggtgcggaggctgttgagaatgccgtaaagatt
gcccgtaactacaccggcaaaaaccgcgtcgtcgtttttgacggtgccttccacggccgc
accaacctcaccatgaccatgaccgccaagaacaagccgtacaagtccggcttcggcacc
ctcgcggccgatatttaccgcgctcccatgtcctacccgctgcgcgatggcctcgatggc
aagcaggccgccgagcgtaccctgcgctacatcgagcagtacgtcggcaccgaagagctc
gccgccgtcatcatcgagcccgtccagggcgagggcggtttcgtcgagccggctaagggt
ttcctcccggcactgcaagagtggtgcaccgacaacggcgttgtcttcgtcgccgacgaa
attcaggctggcatctgccgcaccggctcctggttcgccagcgaggacgagggcatcatc
ccagacctcatcaccactgccaagggcgtcggcggcggcatgccgctgtctgctgtgacc
ggccgtgcggaaatcatggactcccccggtcctggttccctcggtggcacctatgccggt
aacccggtggcctgtgccgcatccctcgccgctttcgaggagatggaagagcttgatctc
aactcccgcgctcgcgagattgaggcaatcatccgcgaggagctggagccgctgctcgaa
ctcaccaccgtggccgaggttcgtggccgtggcgccatgatcgccctcgagctcgtcgat
gacaacaaccagcccaacgccgatctcactgccaaggtagcgaagacctgccgcgagcag
ggcgtcatcgtccttacgtgtggtctggacggcaacgtcatccgcctgctcccaccgctg
gtcatcaacgagtccaccctccgcgacggcctgggcgtgcttgccgacgccatccgcgcc
aactaa

DBGET integrated database retrieval system