KEGG   Cenarchaeum symbiosum: CENSYa_0336Help
Entry
CENSYa_0336       CDS       T01380                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
csy  Cenarchaeum symbiosum
Brite
Enzymes [BR:csy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CENSYa_0336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(285044..285664)
Genome map
AA seq 206 aa AA seqDB search
MGEYTLPEMPYAYDALEPHIDARTMEIHHTKHHQTYTTKLNAALKDCPADIQGKDVTEIL
ANIGQVPEAQRKAINFNAGGYDNHRLFWNNMKPNGGGEPGGAVADAINSSFGSFADFKEK
FSSTTAVIQGSGWGWLVYNPSSSKVEYKAMPNQTSPRTEKLVPLLGCDVWEHAYYLKYQN
KRPDYISAWWNVINWDEVESRLSKAK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgggagaatacacacttccggagatgccatatgcatacgacgcactggagccgcacata
gacgcgcgcaccatggagatacaccatacaaagcaccaccagacgtatactaccaagctc
aacgcggcgctaaaggactgccccgcggatatacagggcaaggacgtcaccgagatcctg
gccaacataggccaggtgcccgaggcgcagcgcaaggcaatcaacttcaatgcaggcggt
tacgacaaccacaggctattctggaacaacatgaagccaaacgggggcggggaacccggc
ggggctgttgccgacgccatcaactcgtcctttggaagctttgcagactttaaggaaaag
ttctcgtccaccactgccgtgatacagggcagcgggtgggggtggctcgtatacaacccg
tcaagcagcaaggtagagtacaaggccatgcccaaccagaccagccccaggactgaaaag
ctggttccgctgcttggctgcgacgtgtgggagcatgcatactatctcaagtaccagaac
aagaggcccgattatatatcggcctggtggaacgtaataaactgggacgaggtcgagagc
aggctttccaaggcaaaatag

DBGET integrated database retrieval system