KEGG   Clostridium tetani E88: CTC_01698Help
Entry
CTC_01698         CDS       T00112                                 

Definition
(GenBank) putative phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
ctc  Clostridium tetani E88
Pathway
ctc00440  Phosphonate and phosphinate metabolism
ctc01100  Metabolic pathways
ctc01120  Microbial metabolism in diverse environments
ctc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ctc00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    CTC_01698
Enzymes [BR:ctc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     CTC_01698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like Ter
Motif
Other DBs
NCBI-ProteinID: AAO36233
UniProt: Q893V9
LinkDB All DBs
Position
complement(1808817..1810121)
Genome map
AA seq 434 aa AA seqDB search
MNNKVTKSVYACFSTGVIHEGHMKIINEAKRYGDVIVGVLSDEACVKFDRFPTTQIEDRV
EMFEELLEVSKVVIQKTTSYRDVLNELKPDYVIHGDNWKSGPQSVIRQEVIEMLKGWNGQ
LIEIPYTRNTNVKKVDDITREKLAMPEYRRKRLRQLLKLRPIVKAIEVHNGITGLIAEKT
VVERNGELDQFDAMWISSLCDSTAKGKPDIELVDMSSRLDTVNDVMEVTTKPIILDGDTG
GLVEHFVYNVRTLERMGVSAVIIEDKTGLKKNSLFGTEVQQTQDTVENFCYKISEAKEVL
RTDEFMIIARIESLILEQGMEDALNRAYAYVNAGADGIMIHSRKKDPTEIFKFCDEFRKT
DKNIPIVVVPTSFNTVTEEEFIAHGVNVVIYANQLTRSAFPAMQQTATKILECHRAKEVD
DNLMSIKDIITLID
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaagtaacaaaaagtgtatatgcgtgttttagtacaggagttatccatgaa
ggacacatgaaaattataaatgaggcaaaaagatatggagacgtaattgttggagtttta
agtgatgaagcttgtgttaagtttgatcgttttccaacaactcaaattgaagatagagtt
gaaatgtttgaagagttgctagaagttagtaaagtggttattcagaaaactacttcttat
agggatgtgctaaatgaattaaaacctgactatgtaatccatggggataattggaaaagt
ggaccacagtcagttataagacaagaagttattgaaatgttaaaaggatggaatgggcaa
ctaattgaaattccatatacaagaaatacaaatgtgaaaaaagttgatgatattacaaga
gaaaagttggcgatgcctgaatatcgtagaaagagattgaggcagttgttaaagcttcgt
ccaattgtaaaggccatagaagtacataatggaattactgggttaattgcagaaaaaacc
gttgttgagcgtaacggagaactagatcagtttgatgcaatgtggatttcaagtctttgt
gattctacagcaaagggaaaacctgatattgaattagttgacatgtcttcaaggcttgat
acagttaatgatgttatggaagttacaactaaacctattatattagatggagatacaggt
gggttagtagaacattttgtatataatgtaagaacacttgaaagaatgggtgtttctgca
gttattattgaagacaaaactggtcttaagaaaaattcattatttggaacagaggttcag
caaactcaagatactgttgaaaacttctgctataaaatcagtgaagcaaaagaggttctt
agaactgatgagttcatgattatagcaagaattgaaagcttaattcttgaacaaggtatg
gaagatgctttaaatagagcttatgcgtatgtgaatgcaggtgctgatggtatcatgata
catagtcgtaaaaaagatcctacagaaatatttaaattctgtgatgaatttaggaaaacg
gataaaaatataccaatagttgttgtgcctacttcttttaatacagttactgaggaagaa
tttattgcacatggggtaaatgttgtaatttatgctaatcagctaacaagaagtgcattt
cctgcaatgcaacaaacagcaacaaaaattcttgagtgtcatagagcaaaagaggttgat
gataatttgatgtcaataaaagacattattacactaattgactaa

DBGET integrated database retrieval system