KEGG   Chlamydia trachomatis D-EC: CTDEC_0294Help
Entry
CTDEC_0294        CDS       T01900                                 

Gene name
sodM
Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ctd  Chlamydia trachomatis D-EC
Brite
Enzymes [BR:ctd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CTDEC_0294 (sodM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ADI50969
LinkDB All DBs
Position
complement(327429..328085)
Genome map
AA seq 218 aa AA seqDB search
MARIVTLFFRMAMVFSSYMLPALPYDYDALEPVISAEIMQLHHQKHHQGYINNLNEALKS
LDVANATQDLARLIAINPALRFNGGSHINHSLFWEMLAPQGKGGGVPPRHELLKLIEKFW
GSFDNFLKNFITSSAAVQGSGWGWLAFCPQKQELMVQTTANQDPLEATTGMIPLLGVDVW
EHAYYLQYKNARMDYLKSFPSIINWDYIENRFVEMSKQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaggatagtaaccttattttttaggatggctatggtcttttcttcttatatgctt
cccgcattgccttatgattacgatgctttagagcctgtaattagtgctgagattatgcaa
ctgcatcatcaaaagcatcaccaaggatatataaataatttgaatgaggccttaaaaagt
ttagatgtagcaaacgctactcaagatttagcaaggttaatcgcaatcaatcctgctctg
cgtttcaatggtggaagccatattaaccactctcttttctgggagatgcttgcgcctcaa
gggaaaggagggggagttcctcctcgtcatgaattgttaaaattaatcgaaaaattctgg
ggctctttcgataactttttaaaaaattttattacttcttctgctgcggtgcaaggatct
ggctggggatggttagctttttgtccccaaaaacaagagcttatggtacagactacagca
aaccaggatcctctggaggcgacgactgggatgatccctctcctaggagtagatgtgtgg
gagcacgcatattatctccagtataaaaatgcgagaatggactatctaaaaagtttcccc
agcataattaattgggattatatagagaatcgctttgtagaaatgagcaagcaataa

DBGET integrated database retrieval system