KEGG   Corynebacterium testudinoris: CTEST_02400Help
Entry
CTEST_02400       CDS       T03956                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cted  Corynebacterium testudinoris
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cted00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CTEST_02400 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CTEST_02400 (alr)
Enzymes [BR:cted01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CTEST_02400 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cted01011]
 Precursor biosynthesis
  Racemase
   CTEST_02400 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
482272..483381
Genome map
AA seq 369 aa AA seqDB search
MSPMDLLSTRIDLDAIAHNTRTIKTLIGEQVRLMAVVKADGYGHGALEAAKVMGANGAEA
FGVATLAEAVALREGGIDTPILAWIWSPDEDITEALALSIELGVPSLRHARALVEAAIPA
RVAIKVDTGLHRSGVDEADWEEVFTLLREAEHLDVTGVFSHLACGDEPFNPANDAQGAAL
VRAIELGRSLGLDLPINHLCNSPGTLTRPDFHHEQVRVGVALYGLEPIDGLSHDLQPAMT
WSAEVITVKPIRPGESVSYGHTWTAEDAGWLALVPAGYADGLPRAWQGTLQVGIGGKLYP
QVGRVCMDQIVVHLGPNEFGVQAGDEAVIFGEGGMSATELAAATDTINYEIVCRPTGRTT
RVYEGGIEL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccatggatcttttgagcacccgcattgatctggacgccatcgcccacaacacg
cgcaccatcaagaccctcattggggaacaggtgcgcctcatggccgtggtgaaggccgat
ggctacgggcatggcgcgctggaagcagcgaaggtgatgggcgcgaacggggcggaagcc
ttcggcgtggccaccctggcggaagcggtggcgctgcgggaggggggcatcgatacgccg
attttggcgtggatctggtccccggacgaggacatcaccgaggcactcgccctctccatt
gagctgggggtgccttccctgcggcacgcccgcgccctggtcgaggccgcgattcccgcg
cgggtggccatcaaggtggataccgggctccatcgttccggggtggatgaggcggactgg
gaggaggtgttcaccctgctgcgcgaggccgagcacctcgacgtcacgggagtgttttcc
cacctggcgtgcggggacgagcccttcaacccggccaacgatgcccagggggcggccttg
gtacgcgccatcgagctgggacgctccctcgggctggacctgccgatcaatcacttgtgc
aactcgccggggacgctgacgcgtccggattttcaccatgagcaggtgcgggtgggtgtc
gcgctttacgggctggagcccatcgacgggctcagccatgacctccagccggcgatgacg
tggtcggcggaggtaatcacggtcaagcccatccgaccgggggaatccgtaagctacggc
cacacctggaccgcggaggacgcagggtggctggcgctggttcccgcgggctacgccgac
gggctgccccgcgcctggcaggggaccctgcaggtgggtatcggcggcaagctctacccg
caggtgggtcgagtgtgcatggaccagatcgtcgtccacctgggccccaacgagttcggg
gttcaggccggggacgaagcagtgattttcggcgagggcgggatgagcgccaccgagctg
gccgccgcgaccgacaccatcaactacgagatcgtgtgccggcccaccgggcgcaccacc
cgggtctacgaaggcggtattgagctgtga

DBGET integrated database retrieval system