KEGG   Candida tenuis: CANTEDRAFT_115643Help
Entry
CANTEDRAFT_115643 CDS       T03099                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cten  Candida tenuis
Pathway
cten00250  Alanine, aspartate and glutamate metabolism
cten00280  Valine, leucine and isoleucine degradation
cten00410  beta-Alanine metabolism
cten00640  Propanoate metabolism
cten00650  Butanoate metabolism
cten01100  Metabolic pathways
Module
cten_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cten00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CANTEDRAFT_115643
   00650 Butanoate metabolism
    CANTEDRAFT_115643
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CANTEDRAFT_115643
   00280 Valine, leucine and isoleucine degradation
    CANTEDRAFT_115643
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CANTEDRAFT_115643
Enzymes [BR:cten01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CANTEDRAFT_115643
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CANTEDRAFT_115643
Amino acid related enzymes [BR:cten01007]
 Aminotransferase (transaminase)
  Class III
   CANTEDRAFT_115643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 18247947
NCBI-ProteinID: XP_006688344
JGI: Cante1_115643
UniProt: G3BBF0
LinkDB All DBs
Position
Unknown
AA seq 491 aa AA seqDB search
MSRALTVKSVFKVPALKIASRHLSTCATYFPGEPGAPVIKTSSVPGPISQQLNDKLGHVF
DNRATYFLTDYYNSIGNYISDADGNLMLDVYAQISSIPLGYNNPELIKTAKSDEMTNALI
NRPALACFPSTDYSKILSEGILAAAPKGMSRVWTALAGSDANETAYKAAFMYQHTKRRGA
SDFSAEELESVMDNKVPGASDMVILSFDKSFHGRLFGSLSTTRSKAIHKLDIPAFNWPKA
PFPSLKYPLDQFEAENRQEEDKCLSEFETIIKNYNGKVAAIIVEPVQSEGGDNHATPYFF
QQLRNITKENDVLMIVDEVQTGVGASGKFWAHEHFDLPSPPDMVTFSKKFQAAGFYFSSA
DLQPKQPYRQFNTWCGDPSKALIARTIYTEVAKHGLVESTSRVGDYLYGKLEALSEKYPI
GNLRGQNFGTFIAWDCKDADQRAHLLGALRNKGINIGGCGDYSIRLRPPLVFEQKHADIL
VGALEAVYAEL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtctagagccctcaccgtcaagtcggtgttcaaggttccggctttaaaaatagcttct
aggcacttgtccacctgtgctacctactttcccggtgagcctggtgcccccgtcatcaaa
acatcatcagttccaggtcccatcagccagcagctcaacgacaagctcggtcacgtgttt
gacaaccgtgccacctactttctcaccgactactacaattccattggtaactacatctct
gatgccgatggaaacttgatgctcgacgtgtacgcacagatctcatccatcccattggga
tataataaccccgagttgatcaagaccgccaagtccgatgagatgaccaacgccttgatc
aacagaccggctttggcatgttttccatccaccgactactcgaagattttatctgaaggg
attttggcagccgctccaaaaggcatgtcgagagtgtggacggccttagcaggctcggac
gccaacgagaccgcgtacaaggccgcgttcatgtatcagcataccaagagaagaggagcc
agcgacttttctgccgaagaattggagtcggtgatggacaataaggttcctggagcctca
gatatggtgattttgtcctttgacaaaagtttccacggccgattgtttggctctctttcc
accactaggtccaaagccatccacaagttggacattccagcattcaactggcccaaggcc
ccatttccttcgttgaagtatcctttggaccaattcgaagcagaaaacagacaagaagaa
gataaatgcctctctgagttcgagaccatcatcaagaactacaacggcaaggtcgcagct
atcatcgtcgaacccgttcagtcggaaggtggtgataaccatgctaccccatacttcttc
cagcagttgagaaacatcaccaaggagaacgatgtgttgatgattgtggatgaagtacaa
acaggagtgggagcttccggcaaattctgggcccatgagcacttcgacttgccctctccg
ccagatatggtgacgttctccaagaagttccaagcggctggattctatttcagtagtgct
gatttgcagccaaaacaaccatacagacagttcaacacttggtgtggagacccatccaaa
gcgttgattgccagaaccatctacacggaggtggccaaacacggcttggtcgagtccact
tctagggtcggagattacttatatggtaagttggaagcattgtcagaaaaatacccaatt
ggcaacttgagaggccagaacttcggaacctttattgcttgggactgcaaagacgccgac
caacgggcccatttgttgggtgctttaagaaacaagggtatcaacattggaggttgtgga
gactattccatcagattgagacctcctttggtattcgagcagaagcacgcagacatcttg
gtgggagctttggaggcagtttatgctgagctttag

DBGET integrated database retrieval system