KEGG   Comamonas testosteroni TK102: O987_25395Help
Entry
O987_25395        CDS       T03218                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ctes  Comamonas testosteroni TK102
Pathway
ctes00010  Glycolysis / Gluconeogenesis
ctes00071  Fatty acid degradation
ctes00350  Tyrosine metabolism
ctes00625  Chloroalkane and chloroalkene degradation
ctes00626  Naphthalene degradation
ctes01100  Metabolic pathways
ctes01110  Biosynthesis of secondary metabolites
ctes01120  Microbial metabolism in diverse environments
ctes01130  Biosynthesis of antibiotics
ctes01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ctes00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O987_25395
  Lipid metabolism
   00071 Fatty acid degradation
    O987_25395
  Amino acid metabolism
   00350 Tyrosine metabolism
    O987_25395
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    O987_25395
   00626 Naphthalene degradation
    O987_25395
Enzymes [BR:ctes01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     O987_25395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AIJ49148
UniProt: A0A076PTT6
LinkDB All DBs
Position
5395397..5396431
Genome map
AA seq 344 aa AA seqDB search
MSLPQTMKAAVVRSFGKPLTIEEMPVPRPTDDQILVKIAASGVCHTDLHAAEGDWPVKPH
PPFIPGHEGVGYVAAVGKNVRHVKEGDRVGVPWLHSACGFCRHCIGGWETLCESQTNTGY
SVNGGFADYALADPNYVGHLPSNVSFIDIAPVLCAGVTVYKGLKVTDAKPGDWVVISGIG
GLGHMAVQYAKAMGFNVAAVDIDDGKLALARQLGATVTVNAKTTDPAAYLQREIEGAHGV
LVTAVSPKAFEQALGMVRRGGTISLNGLPPGDFPLPIFSMVLKGITVRGSIVGTRLDLQE
SLDFAAQGKVKATVSTDKLENINDIFARMHEGKIEGRVVLDIAA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtccttaccccagaccatgaaagccgccgtggtgcgttccttcgggaaaccgctcacg
atcgaagagatgccggtgccacgaccgacagacgatcagatcctggtcaagatcgctgct
tccggcgtctgccacaccgatctgcatgcggccgaaggcgactggcctgtcaagcctcat
ccacccttcattcccggccacgagggcgtgggctatgtggcggcagtgggcaagaacgtc
agacatgtcaaggaaggcgatcgcgtgggcgtgccctggctgcacagcgcctgcggcttc
tgccgccactgcataggcggctgggagaccctgtgcgaatctcagaccaataccggctat
tcggtcaacggcggctttgccgattacgcactggccgatcccaactatgtgggtcatctg
ccgtccaatgtgagctttatcgatatcgctcccgtgctatgcgccggggtcacggtgtac
aagggcctgaaagtcaccgacgccaagcccggcgactgggtggtgatttccggcatcggc
ggcctgggccatatggccgtgcaatatgccaaggccatgggcttcaatgtcgctgccgtc
gacatcgatgacggcaagctcgcgctggcgcgtcagctgggcgccaccgtcactgtcaac
gcaaagaccaccgacccggcggcctatctgcaaagagagattgaaggtgcccatggcgtg
ctggtcaccgccgtgtcgcccaaggctttcgagcaggcgctgggcatggtgcgccgcggc
ggcacgatttcgctcaacggcctgccaccgggcgactttccgctgccgattttctccatg
gtgctcaagggcatcacggtacgcggctccatcgtcggcacgcgcctggacctgcaggag
tcgctggactttgctgcccagggcaaggtcaaggccaccgtgtccaccgacaagctggaa
aacatcaacgacatctttgcccgcatgcacgagggcaagatcgaaggccgcgtggtgctg
gacatcgccgcctga

DBGET integrated database retrieval system