KEGG   Clostridium thermosuccinogenes: CDO33_18200Help
Entry
CDO33_18200       CDS       T05300                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cthd  Clostridium thermosuccinogenes
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cthd00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CDO33_18200
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CDO33_18200
Enzymes [BR:cthd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CDO33_18200
Peptidoglycan biosynthesis and degradation proteins [BR:cthd01011]
 Precursor biosynthesis
  Racemase
   CDO33_18200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4170039..4171208)
Genome map
AA seq 389 aa AA seqDB search
MDYKFNRAWAEVNLDNIAHNVREIRRITDKKAEIMGVVKADAYGHGVMGVAKTLINNGVT
RLAVSMLDEAIQLRNYGIDVPILILSYTDPIRAEEIVKNNVTQTVFSHDLAKALSDAAVR
LKKRVKIHIKIDTGMSRVGFMPGYSAVKNVVEISKLPGIIVEGLFTHFASADEKDKSYTY
MQFERFMSICTELSRIGVHIPIKHVANSATIMEFPEMHLDMVRPGIILYGMYPSEEVNKN
KINLKPAMTLKANVILVKEVEPDTSISYGRIFTTKRTSRIATIPIGYADGYTRLLTGRAK
VLINGEFAPVVGKICMDQCMVDVTDLKSDVRVGDEVVLLGRQGENEITAEDIASAVGTIN
YEMVCLIGKRVPRFYIEGGKISDVLNYLI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggattacaagtttaacagggcatgggcagaggttaatcttgacaatatagcacacaat
gttcgtgaaataagaaggattaccgataaaaaagccgagattatgggagttgtgaaagcc
gacgcttatggccatggtgtgatgggtgttgccaaaactctcataaacaacggggtcacc
cgactggccgtatcgatgctggatgaagcgattcagctcagaaattacgggattgacgtg
cctattttgattttaagctatactgatcccataagagccgaagaaatagtaaaaaacaac
gtgacccagaccgttttcagccatgaccttgcaaaagcgctgtcagacgctgctgtgagg
ctgaaaaaaagggtgaagattcatatcaaaatcgatacgggaatgagcagagtcgggttc
atgccgggttacagcgcggtaaaaaatgtggtggaaatcagcaagcttccgggaattata
gtcgaaggcttgttcacccatttcgcatcggccgacgagaaggacaaaagctacacttat
atgcagtttgagcgtttcatgagcatatgtaccgagttaagccgcatcggggtccatata
ccgataaaacatgttgccaacagcgccactataatggaattccccgaaatgcacctggat
atggtgaggccgggcataattttgtatggaatgtatccttcggaggaagtaaacaagaat
aagataaacctgaagccggctatgaccctaaaggccaatgtaatactggtaaaagaggtt
gaaccggatacaagcatcagctatggaaggatttttaccacaaagcgcaccagcaggata
gccacaattcctatcggttatgctgacggatatacaagattgctgacgggcagagcaaaa
gttttgatcaatggggagtttgcgccggtggtgggaaagatatgcatggatcagtgcatg
gtggatgtgaccgatctaaagtcggatgttcgggtaggagatgaagtcgtgcttttaggc
aggcagggagaaaatgaaataaccgccgaagatatagcttcagctgtaggcaccatcaat
tatgagatggtttgcctgattggcaagagggttccaaggttttatatcgaaggcggaaag
atctccgatgtgctgaattatctcatatag

DBGET integrated database retrieval system