KEGG   Chroococcidiopsis thermalis: Chro_3570Help
Entry
Chro_3570         CDS       T02360                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Chro_3570
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Chro_3570
Transporters [BR:cthe02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Chro_3570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3994031..3994861
Genome map
AA seq 276 aa AA seqDB search
MTATLDRSRKSLQQKAIAKFIAKKVIPPIVAIAIFALIWQLLTMSGILALPSPIEVIQET
WDPYIINPFFDNGGTDKGLALQILASLGRVAIGFSLSAIVGITLGILIGSNEFVYNAVDP
IFQVLRTVPPLAWLPLSLAALQQSNPSAIFVIFITAIWPIIINTTVGVQQLPQDYRNVAR
VLKLRGKKYFFKILFPATVPYIFTGLRIGIGLSWLAIVAAEMLVGGVGIGFFIWDAYNSS
LLSQIIIALIYVGVVGLLLDRIVAFIASKVVPEEQR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaacgctagatcgttcgagaaaaagtttacagcaaaaagcgatcgccaagttt
attgctaaaaaagtgattccaccgatcgtggcgatcgccatttttgcattgatttggcag
ttacttacaatgagtgggattcttgctttgccttcaccgatcgaggtcattcaagaaaca
tgggacccttacatcatcaatcccttttttgataatggcgggacagataagggattagca
ttacaaattctggctagtttgggacgggtcgcaatcggtttttccctctcagctattgtc
ggaattactctgggaattctaattggctcgaatgaatttgtttacaacgctgtagacccg
atttttcaagttcttagaaccgttccacctttggcatggttgcccttatcgttagcagca
ttacaacaatccaatccctccgcaatttttgtaattttcattacagcaatttggcccatc
atcatcaacacaacagtgggcgtacaacaactgcctcaagattatcgcaacgtcgctaga
gttctcaaactcagaggaaaaaaatatttctttaaaattctgtttcccgccaccgtgcct
tacatttttacaggtttgagaatcgggatcggtttatcttggttagcaattgttgccgca
gaaatgttagttggtggagtcggcatcggcttttttatctgggatgcttataacagctct
ttattaagtcaaatcatcatcgcactgatttatgtcggtgtcgtcggtctgctattagac
agaatcgttgctttcattgctagtaaagtcgttccagaagaacagcgatag

DBGET integrated database retrieval system