KEGG   Chroococcidiopsis thermalis: Chro_3719Help
Entry
Chro_3719         CDS       T02360                                 

Definition
(GenBank) amino acid adenylation domain protein
Organism
cthe  Chroococcidiopsis thermalis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4187349..4192658
Genome map
AA seq 1769 aa AA seqDB search
MSEQNNIQSCNAIESMSKFSTIVELLRYRSNIQGEQLSYTFLADGETQSDRLLYQDLDRC
SRAIASQLQSLGLSGERALLLYSPGLEYLAAFFGCLYAGVVAVPAYPPRNQRNTPRILAI
LEDAQAAIILTTTAILPQLQSLFVDKINKIHWLATDNLAPGIEEAWQEPFINIDTLAFLQ
YTSGSTGTPKGVILSHGNLLHNAEVTRQYMEHTSSSKFVSWLPVYHDMGLIGGVLQPLYG
GFPCIMMPPAAFLQRPYRWLQAISRYGGTTSGAPNFAYELCIEKITPEQRSTLDLSNWSV
AFNGAEPIRQETLEKFAATFAECGFRPEAFYPCYGMAEATLMVSGSVKAALVSSIFLQKN
VLEHNRLTHAVANTENSIQLVGCGRVVPQQEVVIANPETLTLCDPDQVGEIWVAGPSIGH
GYWNRLEETEQTFHAYLQDTGQGPFLRTGDLGFLHNGELFITGRAKDLIIIRGRNLYPQD
IELTAERSHKTLRAGSVAAFAVEVEKEERLVVVQELEFRAKPNIDEVTAALRQAITEEHE
VEVYAVVLIKAGTIPKTSSGKIQRRATKAGFLAGTLEVVGSSILEITQTTELEEVLTDKE
LLTLKPKQQQQLLNFYLQKLVAQVLRVKPSQINLEQPLSSLGLDSLKVFELKNRIEVDFG
VTLSVANFFDGAGISELIIQILDKVNNNLTSEYLPISKVETTINQHPLTFTQQQLWFINQ
LQPGTATYNIPVAIHLTGELNVPALVRSLNEIIQRHDILRTSFELVNGEPIQKVAPIAPF
TLPEVDLRHLSDEQKQAEVQKLSLQEAQSSFDLGQAPLLRAKLLHLQTESILLINLHHLV
GDGWSIKVLVQELSTIYQTFANDKICQLPQLPVQYTDFVYWQRNCLQDEVIEKHLVYWKQ
HLGGMPVLQLPTDRPRPPIQTFKGAQQKFVLSPQLTQAIKQLSQKEGVTLFMTLLAAFQT
LLYRYTGQEDILVGSPIANRTRTELEQLIGCFINTLILRTTLEGNPTFTELLGRVRKVAV
EAYTHQDLPFEKLVEALQPNRDLSYNPLFQVMFVLQNPATNSIWKTEEIETGTAKFDVLL
SMIESEEGLTGTLEYNTDLFNADTIARMVGHFQTLLESVVSDSQQRIAELPILTPAERQT
LLVNWNSTQVDYPQYACIHHLFEAQVEKTPDAIALIFANQQLTYRELNNRANQLAHYLQN
LGVKPESLVGICMERSIEMVVGILAIMKAGGAYLPLDPNYPQERLAFMLEDAQLSLLLVQ
LHLVNELPAHTAKVVTIDTDGAAFADYSQANPFISVQLENAAYIIYTSGSTGKPKGAINT
HKGLCNRLLWMQDTYQLEECDRVLQKTPFSFDVSVWEFFWTLFTGATLVIAKPGGHQDAS
YLLQLITQQQITTLHFVPSMLQVFLEEPELEKCHSIKRVICSGEALPFELQKRFFERLDA
ELHNLYGPTEAAIDVTSWKCQKNSNEKIVPIGRPIANIQIYILDNYLQPVPVGIPGELHI
GGVGLARGYLNRPELTNEKFISSPFEPEKRLYKTGDLARYRSDGSIEYSGRIDYQVKIRG
FRIELGEIEEVIAESFNVRETVVLAKENRLIAYVVPKEKITFSINELRHFLKKKLPEYML
PSVFVVLEALPLTSNGKVDRRALPAPDKLRPELANNYQAPQSEVEKLIAKVWKQALQLER
VGVHDNFFDIGGHSLLVVQVSNQLREILNWDLSVVEIFQNPTIKSLAEHLRQKSLAQKNL
EKTHERVGKQREALNQRNQVLMKNRKNLK
NT seq 5310 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacaaaacaatattcaaagctgtaatgctattgaaagcatgagcaaattttcg
actattgttgaacttttgcgttatagaagcaatatacagggcgaacaacttagttacaca
ttcttagcagatggggaaacccaaagcgatcgcctcctttatcaagatctagatagatgt
agtcgggcgatcgcctctcaactccaaagcttaggtttaagtggagagcgtgctttactg
ctttattcaccaggtttagagtatcttgccgcctttttcgggtgtttgtatgctggggtt
gtagcagttccagcttatccaccacgcaaccaacgtaatacccccagaattttagcaatt
ttagaagatgcacaagcagcgataattctgaccaccacagccattttgccgcaattgcaa
tctttgtttgtcgacaaaatcaataagattcactggctagctactgataacctcgctcct
ggtatagaagaagcttggcaagagccttttattaatatagatacattagcctttctgcaa
tatacatctggttctactggtacgcccaaaggtgtaatactcagtcatggcaacctactt
cacaatgctgaggtaacgcgccagtatatggaacatacctctagtagtaagtttgtgagt
tggctgcctgtttatcatgacatgggtttgattggtggcgtactacaacctttatatggt
ggttttccttgtattatgatgccgccagcagcttttctccaacgtccttatcgttggtta
caagcaatttctcgttatggaggaaccaccagtggcgcgcctaactttgcttacgagctt
tgtattgaaaaaattacgcccgaacaacgctcaaccttagatttaagcaattggagtgta
gctttcaatggtgctgaacccattcgtcaagagactctagagaagtttgcagccaccttc
gctgaatgcggttttcgtccagaagctttttatccttgctatggcatggcagaagccact
ttaatggtatctgggagcgtcaaagctgcgttggtaagtagcatatttctgcaaaaaaac
gttttagaacataaccgtctgactcatgcggttgctaacacagagaattcaatacaatta
gtcggatgtggtcgagttgtaccacaacaagaggttgtaattgccaatccagaaacctta
actctgtgcgatcccgaccaagttggggaaatttgggttgcaggtcctagtattggtcat
ggttactggaaccgactagaggaaactgaacaaaccttccacgcttatctacaagacacg
ggacaagggccatttttacggactggggatttaggctttctgcacaatggcgaactcttt
attacaggtagagctaaagatttaattatcatcagagggcgtaatctctacccacaagat
attgagttaaccgcagaacgcagccataaaacattacgagcaggaagtgttgcagctttc
gctgtagaggtagaaaaagaagaacgattggtagttgtacaagaattagagtttcgtgcc
aaacctaatatagatgaagtgacagctgctcttcgccaagcaatcacagaagaacatgaa
gtagaagtttatgcagttgttttaatcaaagccggcactattcccaaaacttctagcggt
aaaatccaacgtcgagctaccaaagcaggatttttagcaggtacattagaggttgttggt
agtagtattctggaaattacccagacaacagaactagaagaagttctgacagacaaagaa
ttactaacactaaaaccaaaacaacaacaacaattattaaacttctatttacaaaagctg
gtagcgcaggtactaagagtaaaaccttcgcaaataaatctagagcaacctttaagtagt
ttgggtctagactccctaaaagttttcgagttaaaaaaccggatcgaggttgattttggc
gtaactctatctgtagctaacttctttgatggtgctggtattagtgagctaataatccaa
atattagataaagttaacaacaacctcactagtgaatacttgcctatctctaaagtagag
acaaccattaaccaacatccacttacctttactcaacagcagttgtggtttatcaatcaa
ctgcaacctggaacagctacatataacattcccgtagctattcatctgacaggagagttg
aatgttcctgcattagtccgtagcctcaacgaaattattcaaagacacgacatcttacga
accagctttgagttagtgaatggtgaacctatccaaaaagttgcacctatagccccattc
actttaccagaagttgatttgcgtcatttgtctgatgaacaaaaacaggctgaagtacaa
aagctatctttgcaagaggctcagtcatcttttgatttaggacaagcacctttgttgcgg
gcaaaactgctgcacttgcaaacagaatcgatattactcataaatctgcatcatttggtt
ggtgatggttggtcaatcaaggtactagttcaagaattatctacaatttatcaaactttt
gctaatgacaaaatatgtcaactacctcagcttcctgtacaatatacagattttgtgtat
tggcaacgaaattgcttgcaagatgaagttatagaaaagcatttagtttattggaagcag
catttaggtggaatgcctgtattgcaattaccgaccgaccgccccagaccaccaatacaa
acttttaaaggagcgcagcagaagtttgtattgtctccacagttaacccaagcaatcaaa
cagttaagccaaaaagaaggtgtaaccttattcatgaccttgctagcggcttttcaaaca
ttgctttaccgctatacaggtcaggaagatattcttgtcggctcaccaattgctaaccgt
acccgtactgaactagaacagctaattgggtgttttattaatactttaatattgcgtacc
actctagaagggaatcccacatttacagaattgttggggcgagtgcgaaaggtagcagtt
gaggcttatactcatcaagatttaccttttgagaagttagtagaagcattacaaccaaat
cgggatctcagctataacccattgttccaggtgatgtttgtgcttcaaaatcctgctaca
aacagcatctggaaaactgaggagatagagacgggaacagccaaatttgatgtccttcta
tcaatgattgagagcgaagaaggattaacaggaacgctagaatacaacaccgatttattt
aatgcagataccatagctaggatggttggacatttccaaaccttgctagagagtgtagtt
agtgattcccagcagcgtattgctgagttaccaatattgacacctgctgaacgtcagacg
ctactagtaaactggaacagcacgcaggttgattatcctcaatacgcttgcattcatcat
ttgtttgaggcgcaggtagaaaaaacaccagatgcgatcgcgctcatttttgctaaccaa
caacttacctatcgagagttaaacaatcgagccaatcaactagctcactacctacaaaat
ttaggggtgaaaccagaatccttagttgggatctgtatggaacgctctatcgaaatggta
gttggaatattagcaattatgaaagcaggcggtgcatatctgccgctagatcctaactat
cctcaagagcgtttggcattcatgctagaagatgctcaattatcattattgctagtgcaa
ctgcatctagttaatgaactaccagcacacacagccaaagtagtaactatagatactgat
ggtgcagcatttgctgactacagccaagctaacccttttattagcgttcagctagaaaat
gcagcttacataatttatacttctggttccacaggaaaacccaaaggagcaattaatact
cataagggtttatgcaaccgcttactatggatgcaagatacttaccaattggaagaatgc
gatcgcgttttacaaaaaacaccctttagttttgatgtttctgtctgggaattcttctgg
actctatttactggcgcaactctagtcatagctaaacccggtggacatcaagatgcaagc
tatctattgcaactcattacccagcagcaaattacgacattgcactttgttccttcaatg
ctgcaagtgtttttagaggaaccagaactagaaaagtgccatagtattaaacgtgtaatt
tgtagtggtgaagcactaccctttgaactacaaaaacgcttctttgagcgtttggatgca
gaattacacaatctctatggtcccacagaagcggcaattgatgtaacttcttggaaatgt
caaaaaaacagcaacgagaaaatagttcctatcggtcgtcctatcgccaacatccagata
tacatattagacaattatttgcaacctgttccagttggtattcctggtgagttgcatatt
ggtggtgtaggtttagcgcggggctatctgaatcgaccagaattgactaatgaaaagttt
atttctagtccgtttgaaccagaaaaacgcctttataaaacaggagatttagcgcgttac
cgttctgatggtagtattgaatactcaggcagaattgactatcaagtaaaaattcgaggt
ttccgtattgaactaggagaaattgaagaagtcatagcagaatctttcaatgtgcgagaa
acggtagttcttgccaaagaaaaccgcctgattgcttatgtagtgcctaaggaaaaaatt
acattttctatcaatgaattgaggcatttcctcaagaaaaagctgcctgaatatatgctt
ccttctgtatttgtagttttagaagcattacctcttacatctaatggcaaagtagaccgt
cgtgctttacctgcgccagataaattgcgtccagaattagcaaataattatcaagcgcct
caatctgaagtagaaaaattaatagctaaggtttggaaacaggcgctacagttagaaaga
gtaggtgttcatgataatttctttgacattggtgggcattcattgttagtggtgcaggtt
agtaaccaacttagagaaatcttgaactgggatttatcagttgtagaaatttttcaaaat
ccgactattaagtcgctggcggaacatttaagacaaaaatcattagcacaaaaaaattta
gagaagacgcatgaaagggtaggcaaacaaagagaagctttgaaccaacgcaatcaagta
ttaatgaaaaaccggaagaatcttaagtaa

DBGET integrated database retrieval system