KEGG   Chroococcidiopsis thermalis: Chro_4612Help
Entry
Chro_4612         CDS       T02360                                 

Definition
(GenBank) glycosyl transferase group 1
Organism
cthe  Chroococcidiopsis thermalis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5182641..5183855
Genome map
AA seq 404 aa AA seqDB search
MKILLINDYGTATGGAELQMLGLRQNLRDRGHDVRLFSSRAMQVASSYCLSDYSCFGTTT
RLQVLSQTVNFSAYLKLRQILHEFRPDVVHVRMFMWQLSPLILTLLKDVPCLYQTAVYKA
ICPVGTKLLPDGRPCKATAGIACLRDRCLTPQSWAVLMVQRQLWQRWRSAFDLVVALSYG
MKAQLEAEGIGAIEVVHNGVPVRPMRPPLANPPTVAFAGRLVSEKGVDVLLRAFARAKAQ
APKAQLLVAGRGSEEDALRALAAELGIATDVTWLGHLPRSEMEKHFDSAWVQVVPSLWSE
PFGNVTTEAMMRGTSVIASAVGAQPEIVVDGITGFLVPPLDVDALTAALLRLLLNASLAE
QMGRVGRQYALTYFSEDRCTERFLEIYQRLRASAVSVSSSRNRS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcttctgatcaatgattatggtacagcaactgggggagccgagttacaaatg
ctaggcttgcgtcagaacttgcgcgatcgcggtcatgatgttcgcctattctctagtcgt
gctatgcaagttgctagcagctactgcctatctgactacagttgttttggcactacaact
cgattgcaagttttgtcccagactgttaatttctctgcctatttaaagctacgccagatt
ctgcatgaatttcgacctgatgtggttcacgtacgcatgtttatgtggcagctttcacca
ctcatccttactttacttaaagacgtgccgtgtttgtaccaaacagccgtgtataaagca
atttgtcctgtaggcacaaaacttttgcccgatggtcgtccctgtaaagctactgctgga
attgcttgtctgcgcgatcgctgccttacacctcaatcttgggcagtattgatggtacag
cggcaactttggcaacgctggcgctctgctttcgatctagtggttgcccttagttacggc
atgaaagcacagttagaagcagaagggattggagcgatcgaagttgtacacaacggtgta
cctgttcgaccgatgcgtccaccccttgccaatcccccaacagttgcttttgctggacgg
ttagtgtcagaaaaaggggttgacgttttgttgcgagcctttgcacgtgctaaagcacaa
gcgcctaaagcgcagttgctcgttgcaggtcggggttcagaggaagatgctttacgagct
ttagcggcggaacttggcattgcaactgacgtgacttggttgggacacttaccacgttct
gaaatggaaaaacattttgattcagcctgggtgcaggtagtaccttcactttggtcagag
ccatttggtaacgtaacaactgaggcaatgatgcgcggtacatctgtcattgctagtgct
gttggcgcacagccagagattgttgttgatggtattacgggttttttagtaccgcctctc
gatgtggatgccttgaccgctgccctgttacgcttattgctcaatgcaagcttagccgag
caaatggggcgagttggtcgtcagtatgctttaacctacttcagtgaagaccgatgtacg
gagcggttcttggaaatttaccagcggctgcgcgcatcggcagtaagcgtatcatcgtcg
cgaaaccgatcatga

DBGET integrated database retrieval system