KEGG   Chlamydia trachomatis J/6276tet1: CTJTET1_01525Help
Entry
CTJTET1_01525     CDS       T02762                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ctjt  Chlamydia trachomatis J/6276tet1
Brite
Enzymes [BR:ctjt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CTJTET1_01525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGS02088
LinkDB All DBs
Position
complement(327937..328557)
Genome map
AA seq 206 aa AA seqDB search
MVFSSYMLPALPYDYDALEPVISAEIMQLHHQKHHQGYINNLNEALKSLDVANATQDLAR
LIAINPALRFNGGSHINHSLFWEMLAPQGKGGGVPPRHELLKLIEKFWGSFDNFLKNFIT
SSAAVQGSGWGWLAFCPQKQELMVQTTANQDPLEATTGMIPLLGVDVWEHAYYLQYKNAR
MDYLKSFPSIINWDYIENRFVEMSKQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggtcttttcttcttatatgcttcccgcattgccttatgattacgatgctttagagcct
gtaattagtgctgagattatgcaactgcatcatcaaaagcatcaccaaggatatataaat
aatttgaatgaggccttaaaaagtttagatgtagcaaacgctactcaagatttagcaagg
ttaatcgcaatcaatcctgctctgcgtttcaatggtggaagccatattaaccactctctt
ttctgggagatgcttgcgcctcaagggaaaggagggggagttcctcctcgtcatgaattg
ttaaaattaatcgaaaaattctggggctctttcgataactttttaaaaaattttattact
tcttctgctgcggtgcaaggatctggctggggatggttagctttttgtccccaaaaacaa
gagcttatggtacagactacagcaaaccaggatcctctggaggcgacgactgggatgatc
cctctcctaggagtagatgtgtgggagcacgcatattatctccagtataaaaatgcgaga
atggactatctaaaaagtttccccagcataattaattgggattatatagagaatcgcttt
gtagaaatgagcaagcaataa

DBGET integrated database retrieval system